Result : O32278
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YwzB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3780162 |
| Right | 3780392 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGTATTGGGACAGCAGGCTGCAATCGGCATTGTCGTTCACCTGATTTTTATAGCAGTGACTTGGTGGGCGTTGCAAGCCGTCAATATAGATCCGTTAATCAAAAAAGGCAAAGTCGTGCAGGCAAGACTCCTGATGATTTTGCTGACAATCGCCATTGGAACGGCCGTTGCCAATTTCTTTTTAGATTACCTCAATTATTCACAGCAGCTTCCCTATCTATTTTAA |
| Sequence | MSVLGQQAAIGIVVHLIFIAVTWWALQAVNIDPLIKKGKVVQARLLMILLTIAIGTAVANFFLDYLNYSQQLPYLF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23817. Profile Description: Protein of unknown function (DUF1146). Members of this protein family are small, typically about 80 residues in length, and are highly hydrophobic. The gene is found so far only in a subset of the Firmicutes in association with genes of the ATP synthase F1 complex or NADH-quinone oxidoreductase. This family includes ywzB from Bacillus subtilis; pfam06612 describes the same family as Protein of unknown function DUF1146. |
| Pubmed ID | 9384377 |
| Domain | CDD:420029 |
| Functional Category | Others |
| Uniprot ID | O32278 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 64
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3780162 | 3780392 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3652488 | 3652718 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3607289 | 3607519 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3669385 | 3669615 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3612864 | 3613094 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3594581 | 3594811 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2458687 | 2458917 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1967666 | 1967896 | + | NZ_CP043404.1 | Bacillus safensis |
| 9 | 2024776 | 2025006 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 10 | 3330650 | 3330880 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 4185149 | 4185382 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 3957174 | 3957407 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3751513 | 3751746 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 3639073 | 3639303 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 15 | 406895 | 407125 | + | NZ_CP011937.1 | Bacillus velezensis |
| 16 | 3078651 | 3078863 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 17 | 3389253 | 3389489 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 18 | 5246027 | 5246212 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 19 | 5208158 | 5208343 | - | NC_011725.1 | Bacillus cereus B4264 |
| 20 | 621024 | 621263 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 5042510 | 5042695 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 5022092 | 5022277 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 23 | 2217669 | 2217863 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 24 | 2790718 | 2790912 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 25 | 3387305 | 3387541 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 26 | 129731 | 129916 | + | NZ_CP040336.1 | Bacillus luti |
| 27 | 775713 | 775952 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 28 | 3864851 | 3865036 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 29 | 2549853 | 2550089 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 30 | 430306 | 430542 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 31 | 2552323 | 2552559 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 32 | 2958647 | 2958850 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 33 | 2631561 | 2631791 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 34 | 376043 | 376282 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 35 | 644719 | 644949 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 36 | 3899363 | 3899548 | - | NZ_LS483476.1 | Lederbergia lentus |
| 37 | 4620244 | 4620489 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 38 | 3192602 | 3192787 | - | NZ_CP012024.1 | Bacillus smithii |
| 39 | 2203956 | 2204201 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 40 | 2409702 | 2409911 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 41 | 2830945 | 2831175 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 42 | 4009482 | 4009667 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 43 | 175246 | 175443 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 44 | 4361580 | 4361774 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 45 | 2958511 | 2958717 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 46 | 4456815 | 4457003 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 47 | 3923151 | 3923336 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 48 | 4902328 | 4902525 | - | NZ_CP053989.1 | Niallia circulans |
| 49 | 1977496 | 1977684 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 50 | 460225 | 460449 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 51 | 2148885 | 2149118 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 52 | 3764578 | 3764835 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 53 | 587043 | 587246 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 54 | 4081240 | 4081443 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 55 | 4243091 | 4243276 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 56 | 4887333 | 4887521 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 57 | 815999 | 816229 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 58 | 2600743 | 2600949 | - | NZ_CP016538.2 | Planococcus maritimus |
| 59 | 2621782 | 2621988 | - | NZ_CP059540.1 | Planococcus maritimus |
| 60 | 2415436 | 2415642 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 61 | 2532974 | 2533180 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 62 | 3636944 | 3637129 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 63 | 3156949 | 3157179 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 64 | 3872434 | 3872667 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 65 | 3133257 | 3133442 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08486.12 | 0.86 | 55 | 2457 | same-strand | Stage II sporulation protein |
| 2 | PF00275.22 | 1.0 | 64 | 912 | same-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
| 3 | PF08680.12 | 0.86 | 55 | 142 | same-strand | TATA-box binding |
++ More..