Result : O32276
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein usd |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3748717 |
| Right | 3748827 |
| Strand | - |
| Nucleotide Sequence | GTGGGCATATTTCACAAACTTACTTTTAAAACCATACAACGAAGAAGCGGCATAATGAACGACTCTTTACAGAATACGGATCTCATTTCACACTTCTCACATCCATTTTAG |
| Sequence | MGIFHKLTFKTIQRRSGIMNDSLQNTDLISHFSHPF |
| Source of smORF | Swiss-Prot |
| Function | Required for translation of SpoIIID. |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32276 |
| ORF Length (Amino Acid) | 36 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3748717 | 3748827 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3570111 | 3570221 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3569744 | 3569854 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3627050 | 3627160 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3615573 | 3615683 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2493310 | 2493420 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3552724 | 3552834 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3905205 | 3905315 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 3701302 | 3701412 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 4134695 | 4134805 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18801.3 | 0.6 | 6 | 3312.5 | opposite-strand | response regulator aspartate phosphatase H, N terminal |
| 2 | PF13424.8 | 0.6 | 6 | 3312.5 | opposite-strand | Tetratricopeptide repeat |
| 3 | PF06429.15 | 1.0 | 10 | 2079.0 | same-strand | Flagellar basal body rod FlgEFG protein C-terminal |
| 4 | PF00460.22 | 1.0 | 10 | 2079.0 | same-strand | Flagella basal body rod protein |
| 5 | PF06723.15 | 1.0 | 10 | 476.0 | same-strand | MreB/Mbl protein |
| 6 | PF14450.8 | 1.0 | 10 | 476.0 | same-strand | Cell division protein FtsA |
| 7 | PF12116.10 | 1.0 | 10 | 15.0 | same-strand | Stage III sporulation protein D |
| 8 | PF01047.24 | 1.0 | 10 | 223.5 | opposite-strand | MarR family |
| 9 | PF12802.9 | 1.0 | 10 | 223.5 | opposite-strand | MarR family |
| 10 | PF13463.8 | 1.0 | 10 | 223.5 | opposite-strand | Winged helix DNA-binding domain |
| 11 | PF01978.21 | 1.0 | 10 | 223.5 | opposite-strand | Sugar-specific transcriptional regulator TrmB |
| 12 | PF13412.8 | 0.9 | 9 | 224 | opposite-strand | Winged helix-turn-helix DNA-binding |
| 13 | PF02133.17 | 0.7 | 7 | 3453 | same-strand | Permease for cytosine/purines, uracil, thiamine, allantoin |
| 14 | PF07690.18 | 0.6 | 6 | 5105.0 | same-strand | Major Facilitator Superfamily |
++ More..