Result : O32235
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YvzC |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3456282 |
| Right | 3456515 |
| Strand | - |
| Nucleotide Sequence | GTGCCAGTAGAAAAGATACAGATTAGACGTGATTATGTCTTGCAGTATATGGTTAATAACGATTATTCCCTTAATCAGCTTGCGCTGGAAATCGGAGTCTCACCCGCCACACTGAGCCGCGTGCTGAATGGAGAAAGAAGGCCGGGGCAGCTTGTGATTGGTAAAATGCTTCACTATTTTAATTTGAAATTTGAGGATCTTTTTTACTATGATTTCGTTGACAAAAGTCAATAA |
| Sequence | MPVEKIQIRRDYVLQYMVNNDYSLNQLALEIGVSPATLSRVLNGERRPGQLVIGKMLHYFNLKFEDLFYYDFVDKSQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9384377 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | O32235 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3456282 | 3456515 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3319440 | 3319673 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3270839 | 3271072 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3266995 | 3267228 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3327005 | 3327238 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2795311 | 2795544 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3243666 | 3243899 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 717672 | 717869 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3338794 | 3338991 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3880248 | 3880478 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2296605 | 2296838 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 3058132 | 3058365 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 2248557 | 2248790 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 3474289 | 3474519 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 3665837 | 3666067 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01668.20 | 1.0 | 15 | 4121 | same-strand | SmpB protein |
| 2 | PF00773.21 | 1.0 | 15 | 1639 | same-strand | RNB domain |
| 3 | PF17876.3 | 1.0 | 15 | 1639 | same-strand | Cold shock domain |
| 4 | PF08206.13 | 1.0 | 15 | 1639 | same-strand | Ribonuclease B OB domain |
| 5 | PF00575.25 | 1.0 | 15 | 1639 | same-strand | S1 RNA binding domain |
| 6 | PF12146.10 | 1.0 | 15 | 873 | same-strand | Serine aminopeptidase, S33 |
| 7 | PF00326.23 | 0.8 | 12 | 1318.0 | same-strand | Prolyl oligopeptidase family |
| 8 | PF03840.16 | 1.0 | 15 | 516 | same-strand | Preprotein translocase SecG subunit |
| 9 | PF13560.8 | 1.0 | 15 | 370.5 | opposite-strand | Helix-turn-helix domain |
| 10 | PF01381.24 | 1.0 | 15 | 370.5 | opposite-strand | Helix-turn-helix |
| 11 | PF12844.9 | 1.0 | 15 | 370.5 | opposite-strand | Helix-turn-helix domain |
| 12 | PF13443.8 | 1.0 | 15 | 370.5 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
| 13 | PF01638.19 | 0.8 | 12 | 1100.0 | opposite-strand | HxlR-like helix-turn-helix |
| 14 | PF00528.24 | 0.6 | 9 | 2184.0 | same-strand | Binding-protein-dependent transport system inner membrane component |
++ More..