Result : A2C127
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NAD(P)H-quinone oxidoreductase subunit L (EC 7.1.1.-) (NAD(P)H dehydrogenase I subunit L) (NDH-1 subunit L) (NDH-L) |
| NCBI Accession ID | CP000553.1 |
| Organism | Prochlorococcus marinus (strain NATL1A) |
| Left | 569690 |
| Right | 569959 |
| Strand | + |
| Nucleotide Sequence | ATGTCTTTGATCTCGATTGTGTGTTTAATCCCTTTTGGATTAATCGGAGCTGTTAATCCAATAATTACATTATCCGCTTATGCGGTATTGGGAGGGATGTATTTATTTGTAGTTCCTTTATTTCTTTTTTATTGGATGAATAATCGTTGGAATGTTATGGGAAAGTTTGAACGCCTTTTTATATATGGACTTGTGTTTCTTTTCTTTCCCGGAATGGTTTTGTTTGCGCCGTTTCTTAATTTAAGAATGAATGGGAAAGAGGAGTCTTGA |
| Sequence | MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLFVVPLFLFYWMNNRWNVMGKFERLFIYGLVFLFFPGMVLFAPFLNLRMNGKEES |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. {ECO:0000255|HAMAP-Rule:MF_01355}. |
| Pubmed ID | 18159947 |
| Domain | CDD:402381 |
| Functional Category | Others |
| Uniprot ID | A2C127 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3246965 | 3247204 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 1904554 | 1904787 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019675.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00290.22 | 1.0 | 2 | 474.5 | same-strand | Tryptophan synthase alpha chain |
| 2 | PF11460.10 | 1.0 | 2 | 58.5 | same-strand | Protein of unknown function (DUF3007) |
++ More..