Result : O32187
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YusU |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3378800 |
| Right | 3379087 |
| Strand | - |
| Nucleotide Sequence | TTGAGAAAGCTCCTTGCTGTTTTTTCGAAAGGAAGATGGAAAATGGAACAAAAACTTCAGGAGCAGCTTGATGGATTGCTGGAGAAGTATACTGAGCTTCTGCTTGGTGAAACAAACGATGAGCTAAAAGAAGAAGTGAAGCAATGGATTTTGTACACCCATATAGCCAAAAGCATGCCTCCGCTCGCTAAGCATTGGAATGCGACATACCCCGACGCGAAGCAGGGCATTAAAGAGATCATTCAGCATATTAAGGAATTAAATGAAGCGCATCGAAACAAACAATAG |
| Sequence | MRKLLAVFSKGRWKMEQKLQEQLDGLLEKYTELLLGETNDELKEEVKQWILYTHIAKSMPPLAKHWNATYPDAKQGIKEIIQHIKELNEAHRNKQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10835. Profile Description: Protein of unknown function (DUF2573). Some members in this bacterial family of proteins are annotated as YusU however no function is currently known. This family of proteins appears to be restricted to Bacillus spp. |
| Pubmed ID | 9384377 |
| Domain | CDD:313925 |
| Functional Category | Others |
| Uniprot ID | O32187 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3378800 | 3379087 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3186927 | 3187214 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3238523 | 3238810 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3246098 | 3246373 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3190509 | 3190754 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3163560 | 3163805 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 805786 | 806031 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 3210760 | 3211005 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3724343 | 3724594 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 3311827 | 3312078 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3536024 | 3536275 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2436043 | 2436294 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 2972903 | 2973154 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 3741478 | 3741729 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 15 | 2336142 | 2336393 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 613304 | 613540 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 2694257 | 2694490 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 18 | 4747193 | 4747450 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 19 | 1843944 | 1844195 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 20 | 4760264 | 4760509 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 21 | 4956755 | 4957000 | - | NC_011725.1 | Bacillus cereus B4264 |
| 22 | 4991427 | 4991672 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 23 | 389070 | 389315 | + | NZ_CP040336.1 | Bacillus luti |
| 24 | 4787839 | 4788084 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 25 | 3895230 | 3895490 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 26 | 1218621 | 1218869 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 27 | 3272936 | 3273184 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 28 | 3599995 | 3600243 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 29 | 2662638 | 2662892 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 30 | 3333164 | 3333415 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 31 | 2835130 | 2835363 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 32 | 4035978 | 4036226 | - | NZ_CP053989.1 | Niallia circulans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT603683.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.69 | 22 | 278.5 | same-strand | ABC transporter |
| 2 | PF02737.20 | 0.72 | 23 | 1513 | same-strand | 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain |
| 3 | PF00725.24 | 0.72 | 23 | 1513 | same-strand | 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain |
++ More..