Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YusG |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3365831 |
Right | 3366067 |
Strand | - |
Nucleotide Sequence | ATGGCTTTCGACAAACAAAAGCTCGATGTCACCAATGACGTGACAGGCCGCTTTCAAAATGGCCGGCTCTCGTTATATCATGATAATGAGATGATCGGCCAAATGACAAGCATGAATGAATATGAGCTTAAGTCCGGTTATTCCTTTGAAAATGAGAAATTTTATAAGACAGCCGATGTGGTCTCTGGAGACGACGCAAAATATGTAGATTGTGACTACGAAAACGGCTGGTGTTAA |
Sequence | MAFDKQKLDVTNDVTGRFQNGRLSLYHDNEMIGQMTSMNEYELKSGYSFENEKFYKTADVVSGDDAKYVDCDYENGWC |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10830. Profile Description: Protein of unknown function (DUF2553). This family of bacterial proteins has no known function. |
Pubmed ID | 9384377 |
Domain | CDD:371262 |
Functional Category | Others |
Uniprot ID | O32173 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3365831 | 3366067 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3173957 | 3174193 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 3225555 | 3225791 | - | NZ_CP033052.1 | Bacillus vallismortis |
4 | 3177544 | 3177780 | - | NZ_CP048852.1 | Bacillus tequilensis |
5 | 3233134 | 3233370 | - | NZ_CP013984.1 | Bacillus inaquosorum |
6 | 3150560 | 3150796 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 2891170 | 2891406 | + | NZ_CP029364.1 | Bacillus halotolerans |
8 | 3194613 | 3194849 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 822141 | 822377 | + | NZ_CP011937.1 | Bacillus velezensis |
10 | 3528347 | 3528583 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
11 | 3304158 | 3304394 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 3716719 | 3716955 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
13 | 622258 | 622494 | + | NZ_CP016020.1 | Bacillus weihaiensis |
14 | 2965142 | 2965378 | - | NZ_CP011150.1 | Bacillus altitudinis |
15 | 2443639 | 2443875 | + | NZ_CP017786.1 | Bacillus xiamenensis |
16 | 2344089 | 2344325 | + | NZ_CP043404.1 | Bacillus safensis |
17 | 4738987 | 4739214 | - | NZ_CP024035.1 | Priestia aryabhattai |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00528.24 | 0.88 | 15 | 2559 | same-strand | Binding-protein-dependent transport system inner membrane component |
2 | PF00005.29 | 1.0 | 17 | 1542 | same-strand | ABC transporter |
3 | PF09383.12 | 1.0 | 17 | 1542 | same-strand | NIL domain |
4 | PF01751.24 | 0.71 | 12 | 31.5 | same-strand | Toprim domain |
5 | PF13662.8 | 0.76 | 13 | 70 | same-strand | Toprim domain |
6 | PF01597.21 | 1.0 | 17 | 56 | same-strand | Glycine cleavage H-protein |
7 | PF03960.17 | 1.0 | 17 | 506 | same-strand | ArsC family |
8 | PF00441.26 | 1.0 | 17 | 973 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
9 | PF02771.18 | 1.0 | 17 | 973 | same-strand | Acyl-CoA dehydrogenase, N-terminal domain |
10 | PF02770.21 | 1.0 | 17 | 973 | same-strand | Acyl-CoA dehydrogenase, middle domain |
11 | PF08028.13 | 1.0 | 17 | 973 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
12 | PF00108.25 | 1.0 | 17 | 2772 | same-strand | Thiolase, N-terminal domain |
13 | PF02803.20 | 1.0 | 17 | 2772 | same-strand | Thiolase, C-terminal domain |
14 | PF02737.20 | 1.0 | 17 | 3959 | same-strand | 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain |
15 | PF00725.24 | 1.0 | 17 | 3959 | same-strand | 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain |