Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YurS |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3354212 |
Right | 3354487 |
Strand | + |
Nucleotide Sequence | ATGAACGAAAACATCATTCCTCTTAACAGACATACTCAAGAGATACCCACTACTGAATCTGTTATCAAAAACAGCGGCAACTCAGAGGTCCATATCGACATTCACATTGATACAATGCCAATTGCTTTTGCTATATTATGCTCTGCATTAGCCGCAAAGCAGATGACAAAAGAGGAATTCGATATGGCTTATACTCAATTGCGAGAGATGAACAGAGAAAATAACAGCAGATCATCTGTAAAGCAAATTATCAATCAAGAGACAGAAGAAGAGTAA |
Sequence | MNENIIPLNRHTQEIPTTESVIKNSGNSEVHIDIHIDTMPIAFAILCSALAAKQMTKEEFDMAYTQLREMNRENNSRSSVKQIINQETEEE |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O32160 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3354212 | 3354487 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3157723 | 3157995 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 2909833 | 2910105 | - | NZ_CP029364.1 | Bacillus halotolerans |
4 | 3162099 | 3162371 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 3221209 | 3221481 | + | NZ_CP013984.1 | Bacillus inaquosorum |
6 | 3139951 | 3140226 | + | NZ_CP051464.1 | Bacillus mojavensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01547.27 | 0.83 | 5 | 3184 | opposite-strand | Bacterial extracellular solute-binding protein |
2 | PF13416.8 | 0.83 | 5 | 3184 | opposite-strand | Bacterial extracellular solute-binding protein |
3 | PF01380.24 | 0.83 | 5 | 2117 | opposite-strand | SIS domain |
4 | PF01541.26 | 1.0 | 6 | 1528.5 | opposite-strand | GIY-YIG catalytic domain |
5 | PF01266.26 | 1.0 | 6 | 308.0 | opposite-strand | FAD dependent oxidoreductase |
6 | PF01458.19 | 0.67 | 4 | 2292.5 | opposite-strand | SUF system FeS cluster assembly, SufBD |
7 | PF01592.18 | 0.67 | 4 | 2645.0 | opposite-strand | NifU-like N terminal domain |
8 | PF00266.21 | 0.67 | 4 | 3078.0 | opposite-strand | Aminotransferase class-V |