Result : O32127
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YutD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3319286 |
| Right | 3319561 |
| Strand | - |
| Nucleotide Sequence | ATGATTCTTATTCAAAATGCCGAATTTGAATTGGTGCACAATTTCAAAGACGGCTTCAACGAAGAGGCTTTTAAAGCCCGCTACTCCGATATATTAAATAAATACGATTATATTGTGGGAGACTGGGGATACGGTCAGTTAAGGCTCAAGGGCTTCTTTGACGACCAGAATCAAAAGGCAACCTTCGAAACGAAAATCAGCACATTAGATGAATATATTTACGAATACTGCAATTTCGGCTGTGCGTATTTTGTCTTGAAACGGATCAGAAAATAA |
| Sequence | MILIQNAEFELVHNFKDGFNEEAFKARYSDILNKYDYIVGDWGYGQLRLKGFFDDQNQKATFETKISTLDEYIYEYCNFGCAYFVLKRIRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09961. Profile Description: Protein of unknown function (DUF1027). This family consists of several hypothetical bacterial proteins of unknown function. |
| Pubmed ID | 9384377 |
| Domain | CDD:415819 |
| Functional Category | Others |
| Uniprot ID | O32127 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 94
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3104223 | 3104498 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 2 | 3183434 | 3183709 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2945005 | 2945280 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 3319286 | 3319561 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 3125475 | 3125750 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 3114155 | 3114430 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 3186316 | 3186591 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 866819 | 867094 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3118473 | 3118748 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2383280 | 2383555 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 3491374 | 3491649 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3668998 | 3669273 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2924387 | 2924662 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 2477095 | 2477370 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 3265888 | 3266163 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 652097 | 652372 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1871370 | 1871645 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 619042 | 619317 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 19 | 2633007 | 2633282 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 20 | 2412398 | 2412673 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 993545 | 993820 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 22 | 45364 | 45639 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 23 | 3025457 | 3025732 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 24 | 3260560 | 3260835 | - | NZ_LS483476.1 | Lederbergia lentus |
| 25 | 3368282 | 3368554 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 26 | 3066810 | 3067085 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 27 | 4022474 | 4022749 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 28 | 3858868 | 3859143 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 29 | 298132 | 298407 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 30 | 2996987 | 2997262 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 31 | 2189090 | 2189365 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 32 | 850484 | 850759 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 33 | 2923605 | 2923880 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 3544702 | 3544983 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 35 | 2695403 | 2695678 | - | NZ_CP012024.1 | Bacillus smithii |
| 36 | 4719680 | 4719937 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 37 | 4749661 | 4749933 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 38 | 4919972 | 4920244 | - | NC_011725.1 | Bacillus cereus B4264 |
| 39 | 4951646 | 4951903 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 40 | 425368 | 425640 | + | NZ_CP040336.1 | Bacillus luti |
| 41 | 3620207 | 3620479 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 42 | 2875312 | 2875587 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 43 | 4003550 | 4003822 | - | NZ_CP053989.1 | Niallia circulans |
| 44 | 1247648 | 1247917 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 45 | 1056688 | 1057008 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 46 | 2438139 | 2438423 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 47 | 1968892 | 1969167 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 48 | 2727911 | 2728186 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 49 | 2163227 | 2163556 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 50 | 2872258 | 2872533 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 51 | 3700267 | 3700548 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 52 | 1548125 | 1548400 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 53 | 2420657 | 2420932 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 54 | 2398368 | 2398640 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 55 | 71373 | 71648 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 56 | 2688109 | 2688384 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 57 | 1241408 | 1241686 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 58 | 919818 | 920141 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 59 | 980358 | 980633 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 60 | 2498949 | 2499224 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 61 | 597480 | 597755 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 62 | 1165920 | 1166243 | + | NZ_CP016538.2 | Planococcus maritimus |
| 63 | 1176645 | 1176968 | + | NZ_CP059540.1 | Planococcus maritimus |
| 64 | 3236303 | 3236578 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 65 | 261122 | 261397 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 66 | 3654373 | 3654648 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 67 | 777075 | 777350 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 68 | 1108149 | 1108475 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 69 | 880640 | 880924 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 70 | 3354186 | 3354431 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 71 | 2475588 | 2475863 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 72 | 2372194 | 2372469 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 73 | 1115959 | 1116285 | + | NZ_CP016540.2 | Planococcus versutus |
| 74 | 2536885 | 2537160 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 75 | 1201586 | 1201909 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 76 | 4721455 | 4721730 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 77 | 1622430 | 1622705 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 78 | 1150526 | 1150852 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 79 | 1771318 | 1771629 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 80 | 2653904 | 2654179 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 81 | 2319131 | 2319409 | - | NZ_LR134483.1 | Listeria grayi |
| 82 | 2392447 | 2392722 | - | NZ_LT906444.1 | Listeria welshimeri |
| 83 | 2386435 | 2386689 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 84 | 1154301 | 1154591 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 85 | 2415418 | 2415693 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 86 | 1245265 | 1245558 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 87 | 719147 | 719458 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 88 | 470698 | 470991 | + | NZ_CP034118.1 | Staphylospora marina |
| 89 | 3066037 | 3066312 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 90 | 88190 | 88501 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 91 | 4579155 | 4579466 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 92 | 1887610 | 1887882 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 93 | 1799592 | 1799864 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 94 | 1720103 | 1720402 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 95 | 437313 | 437579 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13344.8 | 0.8 | 75 | 1029.0 | same-strand | Haloacid dehalogenase-like hydrolase |
| 2 | PF13242.8 | 0.8 | 75 | 1014 | same-strand | HAD-hyrolase-like |
| 3 | PF00702.28 | 0.76 | 71 | 1014 | same-strand | haloacid dehalogenase-like hydrolase |
| 4 | PF01934.19 | 0.77 | 72 | 773.5 | same-strand | Protein of unknown function DUF86 |
| 5 | PF09580.12 | 0.63 | 59 | 117 | opposite-strand | Sporulation lipoprotein YhcN/YlaJ (Spore YhcN YlaJ) |
| 6 | PF04055.23 | 0.61 | 57 | 796 | same-strand | Radical SAM superfamily |
| 7 | PF01551.24 | 0.7 | 66 | 1896.5 | opposite-strand | Peptidase family M23 |
++ More..