Result : O32111
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuzG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3302623 |
| Right | 3302763 |
| Strand | - |
| Nucleotide Sequence | ATGGCCCAAAACGAAGAAAAAACACCGAAGTCCCAAAAGATTCAGGACCGCATTATTATGGCAATGATCTGGGTAGTCGCAGCCCTTGTGATTGCGCTGGTTGTAGGAACTGCATTGAATTATATAAATATCTTCAAATAA |
| Sequence | MAQNEEKTPKSQKIQDRIIMAMIWVVAALVIALVVGTALNYINIFK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32111 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3302623 | 3302763 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3166443 | 3166583 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3166574 | 3166714 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3097935 | 3098075 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2960282 | 2960422 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3103506 | 3103646 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3089087 | 3089227 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3097556 | 3097699 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 888260 | 888403 | + | NZ_CP011937.1 | Bacillus velezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02681.16 | 1.0 | 9 | 4069 | opposite-strand | Divergent PAP2 family |
| 2 | PF06725.13 | 1.0 | 9 | 3386 | same-strand | 3D domain |
| 3 | PF14068.8 | 1.0 | 9 | 2959 | same-strand | Putative membrane protein |
| 4 | PF07992.16 | 1.0 | 9 | 693.5 | both-strands | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF00070.29 | 1.0 | 9 | 693.5 | both-strands | Pyridine nucleotide-disulphide oxidoreductase |
| 6 | PF00478.27 | 1.0 | 9 | 278 | opposite-strand | IMP dehydrogenase / GMP reductase domain |
++ More..