Result : O32110
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuiA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3299718 |
| Right | 3299861 |
| Strand | - |
| Nucleotide Sequence | ATGAAAACTGCAACGACAACCGCTTCACATGCATGCCCATTTTGTTCAGGGAAAGGATATTTTCAATTGATTCTCGGCGGTTCAGAGACTTGTCCGTCTTGCCAGGGGACAGGAAAAGACAGTCATTCTTTTTCCAGCCGTTGA |
| Sequence | MKTATTTASHACPFCSGKGYFQLILGGSETCPSCQGTGKDSHSFSSR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17302. Profile Description: Family of unknown function (DUF5351). This family of unknown function is found in Bacillales. |
| Pubmed ID | 9384377 |
| Domain | CDD:407413 |
| Functional Category | Others |
| Uniprot ID | O32110 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3299718 | 3299861 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3163535 | 3163678 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3100600 | 3100743 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3163668 | 3163811 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2963187 | 2963330 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3086179 | 3086322 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3095027 | 3095170 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3094689 | 3094814 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 891143 | 891268 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3468614 | 3468742 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 3243403 | 3243531 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1256676 | 1256798 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 13 | 679555 | 679677 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 2906653 | 2906778 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 2402098 | 2402223 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3646794 | 3646922 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 17 | 868786 | 868905 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 314931 | 315068 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 19 | 926451 | 926579 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 20 | 2498190 | 2498315 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 21 | 2921999 | 2922127 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 22 | 3204714 | 3204845 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 23 | 2311254 | 2311388 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 24 | 3221566 | 3221703 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 25 | 500083 | 500214 | + | NZ_CP034118.1 | Staphylospora marina |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00883.23 | 0.84 | 21 | 1800 | same-strand | Cytosol aminopeptidase family, catalytic domain |
| 2 | PF02789.19 | 0.84 | 21 | 1800 | same-strand | Cytosol aminopeptidase family, N-terminal domain |
| 3 | PF02681.16 | 0.8 | 20 | 1168.5 | opposite-strand | Divergent PAP2 family |
| 4 | PF06725.13 | 0.84 | 21 | 502 | same-strand | 3D domain |
| 5 | PF14068.8 | 0.92 | 23 | 69 | same-strand | Putative membrane protein |
| 6 | PF07992.16 | 1.0 | 25 | 784 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 7 | PF00070.29 | 1.0 | 25 | 784 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
++ More..