Result : O32097
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3264265 |
| Right | 3264501 |
| Strand | - |
| Nucleotide Sequence | ATGGTCAACCAAGGTAGTCCGCAACTGGTCTCTTTAGTCGATCCTTATGTCTATCAGACCATTAAAAAGCTCATCGGCTCAAGGTTCGTTATACAGACAGTACGAGATACGGTCAGAGGCAGACTGATCGATGTAAAACCTGACCATATCACAATTGAAGGAGCCCGAAATTCTGTTTGTTTGATCAGAATCCAGCACATGATTTCCGTCACCCCAGATTACAGTGAGCGGGTCTAA |
| Sequence | MVNQGSPQLVSLVDPYVYQTIKKLIGSRFVIQTVRDTVRGRLIDVKPDHITIEGARNSVCLIRIQHMISVTPDYSERV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10842. Profile Description: Protein of unknown function (DUF2642). This family of proteins with unknown function appear to be restricted to Bacillus spp. |
| Pubmed ID | 9384377 |
| Domain | CDD:402456 |
| Functional Category | Others |
| Uniprot ID | O32097 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3065139 | 3065375 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 3264265 | 3264501 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 3058180 | 3058416 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3127848 | 3128084 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 3128197 | 3128433 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 3050761 | 3050997 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2998507 | 2998743 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 3059943 | 3060179 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 925775 | 926011 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2520137 | 2520373 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 2425134 | 2425370 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 2884788 | 2885024 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 698667 | 698879 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 2852633 | 2852842 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 15 | 2658776 | 2658997 | + | NZ_AP017312.1 | Aneurinibacillus soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07997.13 | 0.8 | 12 | 2269.5 | same-strand | Protein of unknown function (DUF1694) |
| 2 | PF14166.8 | 0.8 | 12 | 1986.0 | same-strand | YueH-like protein |
| 3 | PF10676.11 | 0.87 | 13 | 1641.0 | same-strand | Spore germination protein gerPA/gerPF |
| 4 | PF01594.18 | 0.87 | 13 | 438 | same-strand | AI-2E family transporter |
| 5 | PF01966.24 | 0.87 | 13 | 186 | same-strand | HD domain |
| 6 | PF00106.27 | 0.87 | 13 | 914 | same-strand | short chain dehydrogenase |
| 7 | PF13561.8 | 0.8 | 12 | 913.5 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 8 | PF17355.4 | 0.8 | 12 | 1710.0 | same-strand | Family of unknown function (DUF5383) |
++ More..