| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore germination protein-like protein YueG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3262330 |
| Right | 3262551 |
| Strand | - |
| Nucleotide Sequence | ATGCCTGCAATTGTGGGGCCGATTTATATCATGTCAGTTACGGATAATGCCGCGGCAAGCTTTGGAGACGTATTTGCGATTTCGCCCAAAAGCGTCGCTCATTCAGGGGCGGGGTCAGGCACATTTCAGCTTGGTGATTTTGTGAAGATTAACAACCAAACGAGTAAAACTCTCTTCAAAGATGCCGATATCACTGATGAAACAGTTTCGTTTAACGGGTAA |
| Sequence | MPAIVGPIYIMSVTDNAAASFGDVFAISPKSVAHSGAGSGTFQLGDFVKINNQTSKTLFKDADITDETVSFNG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10676. Profile Description: Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor. |
| Pubmed ID | 9384377 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | O32094 |
| ORF Length (Amino Acid) | 73 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3262330 | 3262551 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3056351 | 3056572 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3125921 | 3126142 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3126281 | 3126502 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3063204 | 3063425 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 3000349 | 3000570 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3049111 | 3049332 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3058418 | 3058639 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 927316 | 927537 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3216256 | 3216477 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3441111 | 3441332 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3619305 | 3619529 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2882887 | 2883108 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 2522052 | 2522273 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2427044 | 2427265 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3194625 | 3194843 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17767.3 | 0.94 | 15 | 1455 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
| 2 | PF17956.3 | 0.94 | 15 | 1455 | same-strand | Nicotinate phosphoribosyltransferase C-terminal domain |
| 3 | PF04095.18 | 0.94 | 15 | 1455 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) family |
| 4 | PF00857.22 | 0.94 | 15 | 888 | same-strand | Isochorismatase family |
| 5 | PF07997.13 | 0.94 | 15 | 393 | same-strand | Protein of unknown function (DUF1694) |
| 6 | PF14166.8 | 0.94 | 15 | 74 | same-strand | YueH-like protein |
| 7 | PF01594.18 | 0.94 | 15 | 61 | same-strand | AI-2E family transporter |
| 8 | PF10842.10 | 0.75 | 12 | 1676.5 | same-strand | Protein of unknown function (DUF2642) |
| 9 | PF01966.24 | 0.88 | 14 | 2130.0 | same-strand | HD domain |