| Protein name |
Photosystem II reaction center protein M (PSII-M) |
| NCBI Accession ID |
CP000553.1 |
| Organism |
Prochlorococcus marinus (strain NATL1A) |
| Left |
375320 |
| Right |
375478 |
| Strand |
+ |
| Nucleotide Sequence |
ATGGAAACCACTAGTTTTGGCTTTGCCGCAAGTCTTTTATTTGTTGGAGTACCAACTATTTTTCTTATCGGTTTATTTGTTTCTACCAGTGATGGTGAGAAATCAAGCTTTTATTCTGATACCAGCAAGGGTAGATTGAGCCCAGAGCCTAAAAAGTGA |
| Sequence |
METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGRLSPEPKK |
| Source of smORF |
Swiss-Prot |
| Function |
One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. This subunit is found at the monomer-monomer interface. {ECO:0000255|HAMAP-Rule:MF_00438}. |
| Pubmed ID |
18159947
|
| Domain |
CDD:177019,CDD:172584 |
| Functional Category |
Others |
| Uniprot ID |
A2C0G1
|
| ORF Length (Amino Acid) |
52 |