| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YueH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3262009 |
| Right | 3262257 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATCAGAAAAGCAAATATCAATACGCAAACCGGAATGATCACGGACGTGTATCTGCATGAAAACAGAAAAGAACTGCGCACGCTTGTAGCGGTACCGCAGCTGGAGTGGAGCACGATCATTTCCTATGAAGAAGATAAAGCAACTCTGCCTGAACGGCTGGAAGCGTCGTTGCGCCGGCATACAGAGGAAACCCCTGCTGGTGAGCTGGCCAAAAAAATCATTCATTGGGTAACAGAAATGTAA |
| Sequence | MKIRKANINTQTGMITDVYLHENRKELRTLVAVPQLEWSTIISYEEDKATLPERLEASLRRHTEETPAGELAKKIIHWVTEM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14166. Profile Description: YueH-like protein. The YueH-like protein family includes the B. subtilis YueH protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:372940 |
| Functional Category | Others |
| Uniprot ID | O32093 |
| ORF Length (Amino Acid) | 82 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3262009 | 3262257 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3062883 | 3063131 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3056030 | 3056278 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3125960 | 3126208 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3048789 | 3049037 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3000644 | 3000892 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3125595 | 3125846 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 3058097 | 3058345 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 927609 | 927857 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3618982 | 3619230 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3215934 | 3216182 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2522368 | 2522616 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 3440789 | 3441037 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 2882544 | 2882792 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 2427362 | 2427610 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3673064 | 3673303 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17767.3 | 0.94 | 15 | 1133 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
| 2 | PF17956.3 | 0.94 | 15 | 1133 | same-strand | Nicotinate phosphoribosyltransferase C-terminal domain |
| 3 | PF04095.18 | 0.94 | 15 | 1133 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) family |
| 4 | PF00857.22 | 0.94 | 15 | 566 | same-strand | Isochorismatase family |
| 5 | PF07997.13 | 0.94 | 15 | 71 | same-strand | Protein of unknown function (DUF1694) |
| 6 | PF10676.11 | 0.94 | 15 | 74.0 | same-strand | Spore germination protein gerPA/gerPF |
| 7 | PF01594.18 | 0.94 | 15 | 355 | same-strand | AI-2E family transporter |
| 8 | PF10842.10 | 0.75 | 12 | 1990.5 | same-strand | Protein of unknown function (DUF2642) |