Result : O32082
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YubF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3190462 |
| Right | 3190725 |
| Strand | - |
| Nucleotide Sequence | GTGCAGAAATATAGACGCAGAAACACGGTTGCCTTTACAGTACTAGCTTATTTTACTTTTTTTGCGGGAGTATTTTTGTTTAGTATCGGACTCTATAATGCTGATAATCTGGAACTCAATGAAAAAGGTTATTACATCGCTGTTATGATACTTGTAGCAGTTGGTGCGATTCTTACGCAAAAAGTGACCCGTGATAACGCGGAGGATAACGAAATCATCGCGGAACAGGAAAAAAGACAAAATCAATCTCATATCGAATCATAA |
| Sequence | MQKYRRRNTVAFTVLAYFTFFAGVFLFSIGLYNADNLELNEKGYYIAVMILVAVGAILTQKVTRDNAEDNEIIAEQEKRQNQSHIES |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01759. Profile Description: yiaA/B two helix domain. This domain consists of two transmembrane helices and a conserved linking section. |
| Pubmed ID | 9384377 |
| Domain | CDD:413050 |
| Functional Category | Others |
| Uniprot ID | O32082 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2994367 | 2994630 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 3190462 | 3190725 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2992260 | 2992523 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3055485 | 3055748 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3055883 | 3056146 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2976338 | 2976601 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3111818 | 3112081 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1470837 | 1471097 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 9 | 280193 | 280453 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 10 | 224224 | 224484 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1068900 | 1069154 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 12 | 578487 | 578750 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 13 | 5053819 | 5054058 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 14 | 5461090 | 5461326 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 15 | 6683437 | 6683673 | - | NZ_CP009428.1 | Paenibacillus odorifer |
++ More..