Result : O32073
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YtzC |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3119565 |
| Right | 3119837 |
| Strand | - |
| Nucleotide Sequence | GTGGCAACAAGACAATCAGTAGATGAACATCTCCAGCAATGTATGCAGGCCTATGATTATGCTGAAGAACAGCTGAAAATCGCTTCTAAACAAGAGCATTATAACGATCAAGAATATAGTGATGCACAAATGCAGCTAGAAGATGCGGTAAATGCCTTGAATAAACTATGGCTGTCGTCAAATGATCAGCAGAGAGAACAGCTGTACAGAATGAGACTTCAGCTTCAATCTTTGCAAAATAATATGATCCTGCAGCACCCTCTTGATGTGTAG |
| Sequence | MATRQSVDEHLQQCMQAYDYAEEQLKIASKQEHYNDQEYSDAQMQLEDAVNALNKLWLSSNDQQREQLYRMRLQLQSLQNNMILQHPLDV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10732. Profile Description: Protein of unknown function (DUF2524). This family of proteins with unknown function appears to be restricted to Bacillaceae bacteria. |
| Pubmed ID | 9384377 |
| Domain | CDD:287677 |
| Functional Category | Others |
| Uniprot ID | O32073 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3119565 | 3119837 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2998887 | 2999159 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2913730 | 2914002 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 3174476 | 3174748 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 2921943 | 2922215 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 2993708 | 2993980 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2921407 | 2921679 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2938575 | 2938847 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1043684 | 1043956 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3069279 | 3069551 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3254410 | 3254682 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3465423 | 3465701 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 910935 | 911207 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 1966209 | 1966472 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 15 | 3762886 | 3763149 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 16 | 2673811 | 2674086 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 17 | 1106802 | 1107065 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 18 | 2489456 | 2489719 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 2730968 | 2731243 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 20 | 2578452 | 2578727 | + | NZ_CP043404.1 | Bacillus safensis |
| 21 | 2313283 | 2313546 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 22 | 422482 | 422745 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 23 | 166561 | 166824 | - | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 24 | 3545234 | 3545497 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 25 | 2871812 | 2872075 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 26 | 1036476 | 1036739 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 27 | 3049533 | 3049796 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 28 | 3147295 | 3147579 | - | NZ_LS483476.1 | Lederbergia lentus |
| 29 | 2083660 | 2083923 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 30 | 1311261 | 1311536 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 31 | 3723550 | 3723813 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 32 | 3200736 | 3200999 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 33 | 2917299 | 2917565 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 34 | 3481459 | 3481722 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 35 | 4617120 | 4617353 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 36 | 4569254 | 4569517 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 37 | 4705976 | 4706239 | - | NC_011725.1 | Bacillus cereus B4264 |
| 38 | 630011 | 630274 | + | NZ_CP040336.1 | Bacillus luti |
| 39 | 4539861 | 4540124 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 40 | 4748769 | 4749032 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 41 | 2593579 | 2593848 | - | NZ_CP012024.1 | Bacillus smithii |
| 42 | 3807313 | 3807576 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 43 | 2978399 | 2978665 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 44 | 3493943 | 3494206 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 45 | 3060333 | 3060596 | + | NZ_CP022983.1 | Cytobacillus kochii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16199.7 | 0.89 | 40 | 160.0 | opposite-strand | Radical SAM C-terminal domain |
| 2 | PF04055.23 | 0.89 | 40 | 160 | opposite-strand | Radical SAM superfamily |
| 3 | PF06962.14 | 1.0 | 45 | 1119 | opposite-strand | Putative rRNA methylase |
| 4 | PF10776.11 | 0.76 | 34 | 1743.5 | same-strand | Protein of unknown function (DUF2600) |
| 5 | PF12146.10 | 0.62 | 28 | 2940.0 | same-strand | Serine aminopeptidase, S33 |
++ More..