Result : O32067
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YtzE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3072401 |
| Right | 3072622 |
| Strand | + |
| Nucleotide Sequence | TTGAAACCTTCAACAAACCGTATGCTAACTCGAATCAAATCAGTTTACATGTTTATTCAAGAAAAAGGTCTTGTGACAACACAGGAACTGGTTGACGAATTCGGCATTACACCTAGAACGATTCAAAGAGACTTAAATGTGTTGGCATATAATGATCTTGTTCATAGTCCAAGCCGTGGCAAGTGGGAGACAACGAGAAAGAAAGTAAAGATTACCTCATAA |
| Sequence | MKPSTNRMLTRIKSVYMFIQEKGLVTTQELVDEFGITPRTIQRDLNVLAYNDLVHSPSRGKWETTRKKVKITS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21459. Profile Description: Helix-turn-helix domains. This winged helix-turn-helix domain contains an extended C-terminal alpha helix which is responsible for dimerization of this domain. |
| Pubmed ID | 9384377 12618461 |
| Domain | CDD:419669 |
| Functional Category | DNA-binding |
| Uniprot ID | O32067 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 88
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2908035 | 2908256 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 2 | 1074285 | 1074506 | - | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 2946228 | 2946449 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2890837 | 2891058 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2866656 | 2866877 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2874408 | 2874629 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 2951385 | 2951606 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 3221618 | 3221839 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 3072401 | 3072622 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 10 | 2701760 | 2701981 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 2610316 | 2610537 | - | NZ_CP043404.1 | Bacillus safensis |
| 12 | 2698749 | 2698970 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 3035269 | 3035490 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 3219651 | 3219872 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 3424930 | 3425151 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 1981854 | 1982075 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 2305394 | 2305615 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 18 | 932792 | 933013 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 19 | 3883415 | 3883636 | + | NZ_CP053989.1 | Niallia circulans |
| 20 | 2473558 | 2473779 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 21 | 4605731 | 4605952 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 22 | 2577836 | 2578054 | + | NZ_CP012024.1 | Bacillus smithii |
| 23 | 1116554 | 1116775 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 24 | 2335552 | 2335770 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 25 | 2072826 | 2073047 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 26 | 3753428 | 3753649 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 27 | 158207 | 158428 | + | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 28 | 2859957 | 2860178 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 29 | 1050320 | 1050541 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 30 | 3064662 | 3064883 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 31 | 3080801 | 3081022 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 32 | 3708518 | 3708739 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 33 | 3553173 | 3553394 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 34 | 432643 | 432864 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 35 | 1323026 | 1323247 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 36 | 1100926 | 1101147 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 37 | 1100230 | 1100451 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 38 | 2902754 | 2902975 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 39 | 3532413 | 3532634 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 40 | 3123971 | 3124192 | + | NZ_LS483476.1 | Lederbergia lentus |
| 41 | 1209434 | 1209655 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 42 | 2842215 | 2842436 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 43 | 1217837 | 1218058 | - | NZ_CP016540.2 | Planococcus versutus |
| 44 | 1244577 | 1244798 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 45 | 3433020 | 3433241 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 46 | 670006 | 670227 | - | NZ_CP040336.1 | Bacillus luti |
| 47 | 4501738 | 4501959 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 48 | 4529476 | 4529697 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 49 | 4665447 | 4665668 | + | NC_011725.1 | Bacillus cereus B4264 |
| 50 | 4708748 | 4708969 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 51 | 1190905 | 1191126 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 52 | 1185437 | 1185658 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 53 | 3969508 | 3969729 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 54 | 501818 | 502039 | + | NZ_CP013661.2 | Planococcus kocurii |
| 55 | 1279115 | 1279336 | - | NZ_CP019401.1 | Planococcus faecalis |
| 56 | 1274274 | 1274495 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 57 | 1348966 | 1349187 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 58 | 1238289 | 1238510 | - | NZ_CP016538.2 | Planococcus maritimus |
| 59 | 1249278 | 1249499 | - | NZ_CP059540.1 | Planococcus maritimus |
| 60 | 3394677 | 3394895 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 61 | 3777532 | 3777753 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 62 | 3098009 | 3098227 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 63 | 3517124 | 3517342 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 64 | 3092971 | 3093189 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 65 | 3007230 | 3007451 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 66 | 1650119 | 1650340 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 67 | 1217108 | 1217329 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 68 | 1532784 | 1533005 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 69 | 1760637 | 1760858 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 70 | 992892 | 993113 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 71 | 865437 | 865658 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 72 | 3476940 | 3477140 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 73 | 1231192 | 1231407 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 74 | 929310 | 929507 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 75 | 485402 | 485617 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 76 | 2268912 | 2269130 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 77 | 2607987 | 2608205 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 78 | 825435 | 825614 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 79 | 1429313 | 1429534 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 80 | 2118392 | 2118610 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 81 | 1612069 | 1612266 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 82 | 2236229 | 2236447 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 83 | 2340035 | 2340253 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 84 | 2629260 | 2629445 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 85 | 2674069 | 2674287 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 86 | 848891 | 849088 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 87 | 1699814 | 1700032 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 88 | 702290 | 702511 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 89 | 2800435 | 2800632 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006270.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01546.30 | 0.83 | 73 | 400.0 | opposite-strand | Peptidase family M20/M25/M40 |
| 2 | PF00849.24 | 0.97 | 85 | 87.0 | opposite-strand | RNA pseudouridylate synthase |
| 3 | PF01479.27 | 0.97 | 85 | 87.0 | opposite-strand | S4 domain |
| 4 | PF01943.19 | 0.94 | 83 | 903.5 | opposite-strand | Polysaccharide biosynthesis protein |
| 5 | PF14667.8 | 0.94 | 83 | 903.5 | opposite-strand | Polysaccharide biosynthesis C-terminal domain |
| 6 | PF03023.16 | 0.7 | 62 | 923.5 | opposite-strand | Lipid II flippase MurJ |
| 7 | PF01554.20 | 0.61 | 54 | 862 | opposite-strand | MatE |
| 8 | PF03486.16 | 0.81 | 71 | 2725.5 | same-strand | HI0933-like protein |
| 9 | PF02834.18 | 0.66 | 58 | 2909 | opposite-strand | LigT like Phosphoesterase |
++ More..