Result : O32066
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YtzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3060395 |
| Right | 3060673 |
| Strand | + |
| Nucleotide Sequence | ATGGGTTTACATTATGAGCATCAAGTTCATTTATTGAAGGATATATTGACTGACCATCAATTGGACTGCTGCGGAACAGTCGCAGAGTACGAGCAGCTTGAGCGTGTGATTAAATCACTGATGGCAAACACCGAGCTTGATTCAAATTTCAAAAACGTGCTTGAAGATGTTTACCGCTACAGCCAATCAGGAATATCGTCCAAATCCATCGACTCACACATACAAGAGCATCAGAACAGCCTGTCTCAATGGGTAGAGCAAATGGATTCGTATTCCTGA |
| Sequence | MGLHYEHQVHLLKDILTDHQLDCCGTVAEYEQLERVIKSLMANTELDSNFKNVLEDVYRYSQSGISSKSIDSHIQEHQNSLSQWVEQMDSYS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14165. Profile Description: YtzH-like protein. The YtzH-like protein family includes the B. subtilis YtzH protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length. There is a conserved DIL sequence motif. |
| Pubmed ID | 9384377 |
| Domain | CDD:316669 |
| Functional Category | Others |
| Uniprot ID | O32066 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3060395 | 3060673 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2862406 | 2862684 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2939382 | 2939660 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2934025 | 2934303 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2878834 | 2879112 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 2854657 | 2854935 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3233561 | 3233839 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2898134 | 2898412 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1084130 | 1084408 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3024172 | 3024450 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3206767 | 3207045 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3416348 | 3416626 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3451566 | 3451844 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 14 | 4027172 | 4027450 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 15 | 2619001 | 2619276 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 1137428 | 1137703 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 17 | 2710450 | 2710725 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 18 | 2690011 | 2690286 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 19 | 949668 | 949946 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 20 | 3570671 | 3570949 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 21 | 2568145 | 2568423 | + | NZ_CP012024.1 | Bacillus smithii |
| 22 | 150349 | 150618 | + | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 23 | 3427009 | 3427287 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 24 | 3695002 | 3695280 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 25 | 1124576 | 1124845 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 26 | 2464254 | 2464523 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 27 | 3745288 | 3745557 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 28 | 2851630 | 2851899 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 29 | 3072942 | 3073211 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 30 | 2064654 | 2064923 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 31 | 1991889 | 1992167 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 32 | 1328786 | 1329064 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 33 | 1331981 | 1332268 | - | NZ_LS483476.1 | Lederbergia lentus |
| 34 | 675999 | 676277 | - | NZ_CP040336.1 | Bacillus luti |
| 35 | 4659374 | 4659652 | + | NC_011725.1 | Bacillus cereus B4264 |
| 36 | 4702448 | 4702726 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 37 | 4495738 | 4496016 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 38 | 4523399 | 4523677 | + | NZ_CP064875.1 | Bacillus toyonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006270.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05343.16 | 0.95 | 36 | 2508.0 | opposite-strand | M42 glutamyl aminopeptidase |
| 2 | PF03413.21 | 0.95 | 36 | 2031.0 | same-strand | Peptidase propeptide and YPEB domain |
| 3 | PF02390.19 | 1.0 | 38 | 201.0 | opposite-strand | Putative methyltransferase |
| 4 | PF01636.25 | 0.82 | 31 | 1 | opposite-strand | Phosphotransferase enzyme family |
| 5 | PF17999.3 | 0.68 | 26 | 1019.5 | opposite-strand | Pullulanase N1-terminal domain |
| 6 | PF02922.20 | 0.68 | 26 | 1019.5 | opposite-strand | Carbohydrate-binding module 48 (Isoamylase N-terminal domain) |
| 7 | PF02834.18 | 0.89 | 34 | 3713.5 | opposite-strand | LigT like Phosphoesterase |
| 8 | PF01546.30 | 0.76 | 29 | 2506 | opposite-strand | Peptidase family M20/M25/M40 |
++ More..