Result : O32059

Protein Information

• Protein name: Uncharacterized protein YrzH
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2841169
• Right: 2841300
• Strand: +
• Nucleotide Sequence: GTGACGTGGATCAATCACAATACAGTGAAAATCGGCAATCAGACTTTACATCTTGATACTGATGAAACGTATGATTGGCGAAAAGATGATCATTGGATCCGTGAAGAACCGCCGCAGGCGTCAGTGAGGTGA
• Sequence: MTWINHNTVKIGNQTLHLDTDETYDWRKDDHWIREEPPQASVR
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: O32059
• ORF Length (Amino Acid): 43

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2841169	2841300	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	3456076	3456198	-	NZ_CP029364.1	Bacillus halotolerans
3	2574593	2574715	+	NZ_CP051464.1	Bacillus mojavensis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF08955.12	1.0	3	3922	opposite-strand	BofC C-terminal domain
2	PF08977.12	1.0	3	3922	opposite-strand	Bypass of Forespore C, N terminal
3	PF01408.24	1.0	3	1458	opposite-strand	Oxidoreductase family, NAD-binding Rossmann fold
4	PF02894.19	1.0	3	1458	opposite-strand	Oxidoreductase family, C-terminal alpha/beta domain
5	PF01235.19	1.0	3	269	same-strand	Sodium:alanine symporter family
6	PF01709.22	1.0	3	1771	opposite-strand	Transcriptional regulator
7	PF01476.22	1.0	3	3354	opposite-strand	LysM domain
8	PF02445.18	1.0	3	4635	opposite-strand	Quinolinate synthetase A protein