Result : O32052
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec translocon accessory complex subunit YrbF |
| NCBI Accession ID | Y15896.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 14521 |
| Right | 14790 |
| Strand | + |
| Nucleotide Sequence | ATGATGACTGGCACTTTAGGTACATTGGTTCCTATTATTTTAATGTTTGCGGTCCTTTACTTCTTGCTGATTCGTCCTCAGCAAAAGCAGCAAAAGGCTGTACGCCAAATGCAAGAGGAACTGAAAAAAGGCGATTCAGTAGTGACAATCGGGGGATTGCACGGTACTGTTGACTCTATCGACGAAAGCAAAGTCGTAATTAAGACTGGTGATAACACACGTCTTACGTTCGACCGCCGCGCGATCAGAGAAGTTTCTGCTGCTGAATAA |
| Sequence | MMTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVDSIDESKVVIKTGDNTRLTFDRRAIREVSAAE |
| Source of smORF | Swiss-Prot |
| Function | The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes. While the SecYEG complex is essential for assembly of a number of proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these functions. {ECO:0000250|UniProtKB:P0ADZ7}. |
| Pubmed ID | 9384377 |
| Domain | CDD:412579 |
| Functional Category | Others |
| Uniprot ID | O32052 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 136
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2832424 | 2832693 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2713011 | 2713238 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 2665307 | 2665534 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2647614 | 2647841 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2565666 | 2565932 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2641250 | 2641477 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3464856 | 3465122 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2678416 | 2678640 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1309361 | 1309585 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2787543 | 2787767 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2978280 | 2978504 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3126253 | 3126477 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2935767 | 2936033 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2850192 | 2850458 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 2454370 | 2454636 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 1212999 | 1213223 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 2871012 | 2871284 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 18 | 3452896 | 3453144 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 19 | 1317290 | 1317562 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 20 | 1358304 | 1358579 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 2700134 | 2700358 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 22 | 2053577 | 2053840 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 23 | 3376808 | 3377041 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 24 | 3271453 | 3271686 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 25 | 3879638 | 3879907 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 26 | 3499015 | 3499305 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 27 | 682206 | 682478 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 28 | 2231000 | 2231224 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 29 | 3522849 | 3523103 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 30 | 3823781 | 3824026 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 31 | 4277568 | 4277807 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 32 | 1321413 | 1321679 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 33 | 3629534 | 3629779 | - | NZ_CP053989.1 | Niallia circulans |
| 34 | 1807433 | 1807705 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 35 | 4224136 | 4224396 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 36 | 3218780 | 3219043 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 37 | 2360567 | 2360809 | - | NZ_CP012024.1 | Bacillus smithii |
| 38 | 1529806 | 1530042 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 39 | 974591 | 974851 | + | NZ_CP040336.1 | Bacillus luti |
| 40 | 881241 | 881480 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 41 | 4396077 | 4396304 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 42 | 4395847 | 4396107 | - | NC_011725.1 | Bacillus cereus B4264 |
| 43 | 2815223 | 2815456 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 44 | 4260284 | 4260544 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 45 | 2608925 | 2609161 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 46 | 4433779 | 4434039 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 47 | 1860185 | 1860415 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 48 | 2127021 | 2127245 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 49 | 3177999 | 3178259 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 50 | 774747 | 774974 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 51 | 3366460 | 3366678 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 52 | 1603355 | 1603630 | + | NZ_LS483476.1 | Lederbergia lentus |
| 53 | 2323811 | 2324032 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 54 | 3597570 | 3597797 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 55 | 2369385 | 2369609 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 56 | 3643860 | 3644087 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 57 | 1843344 | 1843562 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 58 | 2603714 | 2603941 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 59 | 3329993 | 3330220 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 60 | 3174382 | 3174690 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 61 | 2049542 | 2049772 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 62 | 1690218 | 1690442 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 63 | 1220468 | 1220695 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 64 | 2953651 | 2953887 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 65 | 1088164 | 1088382 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 66 | 2268392 | 2268643 | + | NZ_AP019400.1 | Cohnella abietis |
| 67 | 2498045 | 2498290 | - | NZ_CP033433.1 | Cohnella candidum |
| 68 | 1026601 | 1026825 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 69 | 2784012 | 2784251 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 70 | 7252126 | 7252371 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 71 | 150602 | 150829 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 72 | 1583135 | 1583356 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 73 | 3091134 | 3091355 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 74 | 2311062 | 2311298 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 75 | 964061 | 964312 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 76 | 1786038 | 1786262 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 77 | 5330515 | 5330763 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 78 | 1556339 | 1556587 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 79 | 1330789 | 1331025 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 80 | 4936051 | 4936329 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 81 | 3949184 | 3949414 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 82 | 4688162 | 4688410 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 83 | 2618905 | 2619147 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 84 | 1758018 | 1758245 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 85 | 2128365 | 2128631 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 86 | 249079 | 249327 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 87 | 1811141 | 1811359 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 88 | 5374608 | 5374829 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 89 | 4248335 | 4248559 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 90 | 388810 | 389073 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 91 | 2536124 | 2536360 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 92 | 1192016 | 1192249 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 93 | 222780 | 223007 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 94 | 1297519 | 1297740 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 95 | 6398732 | 6398971 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 96 | 1903743 | 1903964 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 97 | 335761 | 335991 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 98 | 6179308 | 6179538 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 99 | 353573 | 353803 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 100 | 5623147 | 5623377 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 101 | 3182811 | 3183077 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 102 | 1472965 | 1473231 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 103 | 929688 | 929924 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 104 | 4567419 | 4567649 | - | NZ_CP009288.1 | Paenibacillus durus |
| 105 | 1558787 | 1559017 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 106 | 1337733 | 1337969 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 107 | 5406753 | 5406971 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 108 | 6074656 | 6074892 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 109 | 2531206 | 2531445 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 110 | 5095671 | 5095898 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 111 | 420129 | 420353 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 112 | 1341152 | 1341388 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 113 | 1843447 | 1843674 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 114 | 2602183 | 2602410 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 115 | 2231863 | 2232090 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 116 | 985158 | 985385 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 117 | 1170329 | 1170601 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 118 | 2237155 | 2237427 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 119 | 1042297 | 1042521 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 120 | 246063 | 246281 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 121 | 3473579 | 3473869 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 122 | 1364377 | 1364604 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 123 | 1419103 | 1419330 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 124 | 324843 | 325070 | - | NZ_CP013661.2 | Planococcus kocurii |
| 125 | 1458050 | 1458277 | + | NZ_CP019401.1 | Planococcus faecalis |
| 126 | 1386412 | 1386639 | + | NZ_CP016540.2 | Planococcus versutus |
| 127 | 1535461 | 1535688 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 128 | 1449322 | 1449543 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 129 | 89457 | 89684 | + | NZ_CP037922.1 | Hymenobacter radiodurans |
| 130 | 1423185 | 1423406 | + | NZ_CP059540.1 | Planococcus maritimus |
| 131 | 1166266 | 1166487 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 132 | 3257347 | 3257571 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 133 | 2798823 | 2799068 | - | NC_014230.1 | Croceibacter atlanticus HTCC2559 |
| 134 | 2062025 | 2062249 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 135 | 975807 | 976025 | + | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 136 | 1095366 | 1095605 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02355.18 | 0.71 | 96 | 3288.0 | same-strand | Protein export membrane protein |
| 2 | PF13797.8 | 0.79 | 107 | 2997 | same-strand | Post-transcriptional regulator |
| 3 | PF01943.19 | 0.74 | 100 | 1367.5 | opposite-strand | Polysaccharide biosynthesis protein |
| 4 | PF14667.8 | 0.74 | 100 | 1367.5 | opposite-strand | Polysaccharide biosynthesis C-terminal domain |
| 5 | PF01554.20 | 0.74 | 100 | 1367.5 | opposite-strand | MatE |
| 6 | PF12670.9 | 0.71 | 96 | 97.0 | opposite-strand | Protein of unknown function (DUF3792) |
| 7 | PF01702.20 | 0.91 | 124 | 81.5 | same-strand | Queuine tRNA-ribosyltransferase |
| 8 | PF02547.17 | 0.91 | 124 | 1253.0 | same-strand | Queuosine biosynthesis protein |
| 9 | PF05496.14 | 0.89 | 121 | 2487 | same-strand | Holliday junction DNA helicase RuvB P-loop domain |
| 10 | PF17864.3 | 0.89 | 121 | 2487 | same-strand | RuvB AAA lid domain |
| 11 | PF05491.15 | 0.9 | 122 | 2487.5 | same-strand | RuvB C-terminal winged helix domain |
| 12 | PF00004.31 | 0.9 | 123 | 2487 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 13 | PF07728.16 | 0.89 | 121 | 2487 | same-strand | AAA domain (dynein-related subfamily) |
| 14 | PF01330.23 | 0.84 | 114 | 3502.5 | same-strand | RuvA N terminal domain |
| 15 | PF14520.8 | 0.84 | 114 | 3502.5 | same-strand | Helix-hairpin-helix domain |
| 16 | PF07499.15 | 0.84 | 114 | 3502.5 | same-strand | RuvA, C-terminal domain |
++ More..