Result : O32049
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Post-transcriptional regulator ComN |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2829152 |
| Right | 2829448 |
| Strand | - |
| Nucleotide Sequence | GTGGAGAAGCATCCAGCCGATCTATATAAAGACCACGTCAGGCCGTTTCTTTACAGCAAACTGGAAGAGTTTAAGATTCTCGGGTATGATGATGTTGAACTCGAAAGTTTGTGGTCATACTTAACAGATAAGAAGTGGAAAAAGAAAACGGAACTGAGCATTTATGAACTGGCGAGTGATATTTTATCAGTGAAAATTGGCGAATTTATGAACTATGCAACCGTTGAGTCATTTAAAACGTCTAATTGGCTGGGCAGTGAAGAGGGCCAGGAAGCATTGGAAGAACTGCTGAGATAG |
| Sequence | MEKHPADLYKDHVRPFLYSKLEEFKILGYDDVELESLWSYLTDKKWKKKTELSIYELASDILSVKIGEFMNYATVESFKTSNWLGSEEGQEALEELLR |
| Source of smORF | Swiss-Prot |
| Function | Required for post-transcription initiation control of the comE operon. Promotes the accumulation of its target comE mRNA to septal and polar sites. {ECO:0000269|Pubmed:19028902, ECO:0000269|Pubmed:22582279}. |
| Pubmed ID | 9384377 19028902 22582279 |
| Domain | CDD:404651 |
| Functional Category | Others |
| Uniprot ID | O32049 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2829152 | 2829448 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2644357 | 2644653 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2709742 | 2710038 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2661911 | 2662207 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2637977 | 2638273 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 3468097 | 3468393 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2562397 | 2562693 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2675179 | 2675475 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1312526 | 1312822 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2784181 | 2784477 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3123013 | 3123309 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 2974938 | 2975234 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 2853368 | 2853664 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2938960 | 2939256 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2451150 | 2451446 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 1218512 | 1218805 | + | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10141.11 | 1.0 | 16 | 3378.0 | same-strand | Single-strand DNA-specific exonuclease, C terminal domain |
| 2 | PF17768.3 | 1.0 | 16 | 3378.0 | same-strand | RecJ OB domain |
| 3 | PF02272.21 | 1.0 | 16 | 3378.0 | same-strand | DHHA1 domain |
| 4 | PF01368.22 | 1.0 | 16 | 3378.0 | same-strand | DHH family |
| 5 | PF06305.13 | 1.0 | 16 | 2984.0 | same-strand | Lipopolysaccharide assembly protein A domain |
| 6 | PF02080.23 | 0.81 | 13 | 2410 | same-strand | TrkA-C domain |
| 7 | PF02355.18 | 1.0 | 16 | 39.0 | same-strand | Protein export membrane protein |
| 8 | PF07549.16 | 0.69 | 11 | 38 | same-strand | SecD/SecF GG Motif |
| 9 | PF01943.19 | 1.0 | 16 | 116.0 | opposite-strand | Polysaccharide biosynthesis protein |
| 10 | PF14667.8 | 1.0 | 16 | 116.0 | opposite-strand | Polysaccharide biosynthesis C-terminal domain |
| 11 | PF01554.20 | 1.0 | 16 | 116.0 | opposite-strand | MatE |
| 12 | PF03023.16 | 0.75 | 12 | 116.0 | opposite-strand | Lipid II flippase MurJ |
| 13 | PF04239.14 | 1.0 | 16 | 1676.0 | same-strand | Protein of unknown function (DUF421) |
| 14 | PF12670.9 | 1.0 | 16 | 2500.0 | opposite-strand | Protein of unknown function (DUF3792) |
| 15 | PF02699.17 | 1.0 | 16 | 2973.0 | same-strand | Preprotein translocase subunit |
| 16 | PF01702.20 | 0.94 | 15 | 3279 | same-strand | Queuine tRNA-ribosyltransferase |
++ More..