Result : O32040
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrzK |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2818191 |
| Right | 2818361 |
| Strand | - |
| Nucleotide Sequence | ATGAAATATCATCCAAAAATGGGACGTGCATTTCACGACGGTGAAGCGAATCTGCATTACAGCGATCACGCAGATCCCGATACGACTGGTTATCTTACGGAAACAGCATCTGAATTTGGTCTTATGTCCAAAGAAGCAGCGCTGAGGAAAAACAACCGGAATAAAGCTTGA |
| Sequence | MKYHPKMGRAFHDGEANLHYSDHADPDTTGYLTETASEFGLMSKEAALRKNNRNKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17449. Profile Description: Uncharacterized protein YrzK. This is a family of unknown function found in Bacillus. |
| Pubmed ID | 9384377 |
| Domain | CDD:340164 |
| Functional Category | Others |
| Uniprot ID | O32040 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2818191 | 2818361 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2650955 | 2651125 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2633401 | 2633571 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2627009 | 2627179 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2698773 | 2698943 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2551423 | 2551593 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3479194 | 3479364 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1323568 | 1323738 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2664261 | 2664431 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2964547 | 2964711 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2773787 | 2773951 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 3111919 | 3112083 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12002.10 | 0.92 | 11 | 4591 | opposite-strand | MgsA AAA+ ATPase C terminal |
| 2 | PF16193.7 | 0.92 | 11 | 4591 | opposite-strand | AAA C-terminal domain |
| 3 | PF00004.31 | 0.92 | 11 | 4591 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF13173.8 | 0.92 | 11 | 4591 | opposite-strand | AAA domain |
| 5 | PF00152.22 | 1.0 | 12 | 1664.5 | same-strand | tRNA synthetases class II (D, K and N) |
| 6 | PF02938.16 | 1.0 | 12 | 1664.5 | same-strand | GAD domain |
| 7 | PF01336.27 | 1.0 | 12 | 1664.5 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF13393.8 | 1.0 | 12 | 376.0 | same-strand | Histidyl-tRNA synthetase |
| 9 | PF03129.22 | 1.0 | 12 | 376.0 | same-strand | Anticodon binding domain |
| 10 | PF00587.27 | 1.0 | 12 | 376.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 11 | PF08239.13 | 1.0 | 12 | 133.0 | opposite-strand | Bacterial SH3 domain |
| 12 | PF01520.20 | 1.0 | 12 | 133.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
| 13 | PF06347.15 | 1.0 | 12 | 133.0 | opposite-strand | Bacterial SH3 domain |
| 14 | PF02580.18 | 1.0 | 12 | 1714.5 | same-strand | D-Tyr-tRNA(Tyr) deacylase |
| 15 | PF13328.8 | 1.0 | 12 | 2167.0 | same-strand | HD domain |
| 16 | PF04607.19 | 1.0 | 12 | 2167.0 | same-strand | Region found in RelA / SpoT proteins |
| 17 | PF02824.23 | 1.0 | 12 | 2167.0 | same-strand | TGS domain |
| 18 | PF13291.8 | 1.0 | 12 | 2167.0 | same-strand | ACT domain |
| 19 | PF19296.1 | 1.0 | 12 | 2167.0 | same-strand | Domain of unknown function (DUF5913) |
| 20 | PF01966.24 | 1.0 | 12 | 2167.0 | same-strand | HD domain |
| 21 | PF01842.27 | 1.0 | 12 | 2167.0 | same-strand | ACT domain |
| 22 | PF10141.11 | 1.0 | 12 | 5055.5 | same-strand | Single-strand DNA-specific exonuclease, C terminal domain |
| 23 | PF17768.3 | 1.0 | 12 | 5055.5 | same-strand | RecJ OB domain |
| 24 | PF02272.21 | 1.0 | 12 | 5055.5 | same-strand | DHHA1 domain |
| 25 | PF01368.22 | 1.0 | 12 | 5055.5 | same-strand | DHH family |
++ More..