Result : O32030
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrzA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2788680 |
| Right | 2788883 |
| Strand | + |
| Nucleotide Sequence | ATGAATTTTCAATTAGATCTGATTAAAGACAAAGTGGAATTTTTTGAAGCGGCTTCATTGCAGGAGCTTGAAAAGAAAATCAATACACAAATTGAAAACAATAAAGCCATCATGCTCCGGGTGAAATCTGTTTCACACCAAACTCTTGTGGCAGAAGGAAGAATATTGTACAGCGCGGTGGTTCATTTCTCAGCTGAAGCCTAA |
| Sequence | MNFQLDLIKDKVEFFEAASLQELEKKINTQIENNKAIMLRVKSVSHQTLVAEGRILYSAVVHFSAEA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10750. Profile Description: Protein of unknown function (DUF2536). This family of proteins with unknown function appears to be restricted to Bacillus spp. Structural modelling suggests this domain may bind nucleic acids. |
| Pubmed ID | 9384377 |
| Domain | CDD:371221 |
| Functional Category | Others |
| Uniprot ID | O32030 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2788680 | 2788883 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2672103 | 2672306 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 2606976 | 2607179 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2599250 | 2599453 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2621384 | 2621587 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 3508738 | 3508941 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2524940 | 2525143 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1353133 | 1353336 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2634702 | 2634905 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3080047 | 3080247 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2937355 | 2937558 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 2746651 | 2746854 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2981178 | 2981381 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2898558 | 2898761 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 2406440 | 2406646 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 2091957 | 2092157 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 17 | 2184286 | 2184492 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 4009891 | 4010094 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 19 | 3425701 | 3425910 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 20 | 1267018 | 1267221 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 3479147 | 3479353 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 22 | 1401358 | 1401564 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 23 | 773489 | 773701 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 24 | 814468 | 814674 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 25 | 3320743 | 3320949 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 26 | 4386714 | 4386926 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 27 | 3570109 | 3570321 | + | NZ_CP053989.1 | Niallia circulans |
| 28 | 3450510 | 3450716 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 29 | 725022 | 725195 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 30 | 3407042 | 3407251 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 31 | 2557313 | 2557501 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 32 | 3378126 | 3378314 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 33 | 1760445 | 1760633 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 34 | 1363934 | 1364122 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 35 | 2647807 | 2647980 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 36 | 3169066 | 3169278 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 37 | 2010687 | 2010890 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 38 | 3126052 | 3126267 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 39 | 2352963 | 2353169 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 40 | 4352535 | 4352750 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 41 | 3956024 | 3956233 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 42 | 1016887 | 1017102 | - | NZ_CP040336.1 | Bacillus luti |
| 43 | 4182953 | 4183168 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 44 | 4353340 | 4353555 | + | NC_011725.1 | Bacillus cereus B4264 |
| 45 | 4217923 | 4218138 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 46 | 3022116 | 3022304 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 47 | 5629196 | 5629402 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 48 | 4391905 | 4392120 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 49 | 4675859 | 4676065 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 50 | 995265 | 995474 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 51 | 87803 | 88006 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 52 | 1740311 | 1740520 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01053.22 | 0.75 | 39 | 2526 | opposite-strand | Cys/Met metabolism PLP-dependent enzyme |
| 2 | PF00291.27 | 0.77 | 40 | 1602.5 | opposite-strand | Pyridoxal-phosphate dependent enzyme |
| 3 | PF01048.22 | 0.87 | 45 | 846 | opposite-strand | Phosphorylase superfamily |
| 4 | PF13649.8 | 0.79 | 41 | 189.5 | opposite-strand | Methyltransferase domain |
| 5 | PF08241.14 | 0.77 | 40 | 188.5 | opposite-strand | Methyltransferase domain |
| 6 | PF13489.8 | 0.65 | 34 | 190.0 | opposite-strand | Methyltransferase domain |
| 7 | PF08242.14 | 0.77 | 40 | 188.5 | opposite-strand | Methyltransferase domain |
| 8 | PF07423.13 | 0.87 | 45 | 40 | opposite-strand | Domain of unknown function (DUF1510) |
| 9 | PF00905.24 | 0.81 | 42 | 803.0 | opposite-strand | Penicillin binding protein transpeptidase domain |
| 10 | PF03449.17 | 0.85 | 44 | 2666.0 | opposite-strand | Transcription elongation factor, N-terminal |
| 11 | PF01272.21 | 0.85 | 44 | 2666.0 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
| 12 | PF00485.20 | 0.85 | 44 | 3354.0 | opposite-strand | Phosphoribulokinase / Uridine kinase family |
| 13 | PF13238.8 | 0.85 | 44 | 3354.0 | opposite-strand | AAA domain |
| 14 | PF01136.21 | 0.65 | 34 | 3976.5 | opposite-strand | Peptidase family U32 |
| 15 | PF16325.7 | 0.65 | 34 | 3976.5 | opposite-strand | Peptidase family U32 C-terminal domain |
++ More..