Result : O32027
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YrzI |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2778923 |
| Right | 2779072 |
| Strand | - |
| Nucleotide Sequence | ATGACGATTAACCTATTCTTTTTAACGTTAACGATTAAAAAACGGTTTAAAAGCCTGGAAGAATTCGAACGAGAACAGCAGATTGAACAAATTTATGATGAAATGAAAGAGTCTCAGTTAAAGCATCTTTATTTAACAAACTGGCGCTAA |
| Sequence | MTINLFFLTLTIKKRFKSLEEFEREQQIEQIYDEMKESQLKHLYLTNWR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23890. Profile Description: Probable sporulation protein (Bac_small_yrzI). Members of this family are very small proteins, about 47 residues each, in the genus Bacillus. Single members are found in Bacillus subtilis and Bacillus halodurans, but arrays of six in tandem in Bacillus cereus and Bacillus anthracis. An EIxxE motif present in most members of this family resembles cleavage sites by the germination protease GPR in a number small, acid-soluble spore proteins (SASP). A role in sporulation is possible. |
| Pubmed ID | 9384377 |
| Domain | CDD:329155 |
| Functional Category | Others |
| Uniprot ID | O32027 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2778923 | 2779072 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2611631 | 2611780 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2515175 | 2515324 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 2589492 | 2589641 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2660360 | 2660509 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2593916 | 2594065 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 1362930 | 1363070 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 2624973 | 2625113 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3518556 | 3518705 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 2742103 | 2742252 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2903171 | 2903305 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 255691 | 255825 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 3075514 | 3075663 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 2932811 | 2932960 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 2985985 | 2986119 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 2401899 | 2402033 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 17 | 2687529 | 2687672 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00067.24 | 0.69 | 11 | 1876 | same-strand | Cytochrome P450 |
| 2 | PF00667.22 | 0.69 | 11 | 1876 | same-strand | FAD binding domain |
| 3 | PF00258.27 | 0.69 | 11 | 1876 | same-strand | Flavodoxin |
| 4 | PF00175.23 | 0.69 | 11 | 1876 | same-strand | Oxidoreductase NAD-binding domain |
| 5 | PF16295.7 | 0.75 | 12 | 1273.0 | same-strand | Tetracyclin repressor-like, C-terminal domain |
| 6 | PF00440.25 | 0.75 | 12 | 1273.0 | same-strand | Bacterial regulatory proteins, tetR family |
| 7 | PF08241.14 | 0.94 | 15 | 759 | same-strand | Methyltransferase domain |
| 8 | PF13649.8 | 0.94 | 15 | 759 | same-strand | Methyltransferase domain |
| 9 | PF08242.14 | 0.94 | 15 | 759 | same-strand | Methyltransferase domain |
++ More..