Result : O32025
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphatase RapE inhibitor (Phosphatase regulator E) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2660330 |
| Right | 2660464 |
| Strand | + |
| Nucleotide Sequence | ATGAAATCTAAATTGTTTATCAGTTTATCCGCCGTTTTAATTGGACTTGCCTTTTTCGGATCTATGTATAATGGCGAAATGAAGGAAGCATCCCGGAATGTAACTCTCGCACCTACTCATGAATTCCTTGTTTAA |
| Sequence | MKSKLFISLSAVLIGLAFFGSMYNGEMKEASRNVTLAPTHEFLV |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the activity of phosphatase RapE. |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32025 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2660330 | 2660464 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3590577 | 3590711 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 3 | 2563878 | 2564012 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2536194 | 2536304 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029364.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18801.3 | 1.0 | 3 | 247.5 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 2 | PF07719.19 | 1.0 | 3 | 36.5 | same-strand | Tetratricopeptide repeat |
| 3 | PF13424.8 | 0.67 | 2 | -10.0 | same-strand | Tetratricopeptide repeat |
| 4 | PF00515.30 | 1.0 | 3 | -10 | same-strand | Tetratricopeptide repeat |
| 5 | PF13181.8 | 0.67 | 2 | 83 | same-strand | Tetratricopeptide repeat |
| 6 | PF04740.14 | 0.67 | 2 | 638.0 | same-strand | LXG domain of WXG superfamily |
| 7 | PF01545.23 | 0.67 | 2 | 1568.0 | opposite-strand | Cation efflux family |
| 8 | PF16916.7 | 0.67 | 2 | 1568.0 | opposite-strand | Dimerisation domain of Zinc Transporter |
++ More..