Result : O32020
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqzE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2555887 |
| Right | 2556066 |
| Strand | - |
| Nucleotide Sequence | GTGAAAACGAATGATTATGTTAAATATATGACGCAGCAATTTGTCAAATATATAGATACTCCGAGAGATGAGCGAAAAGAACGAAAAGAGGTGCGGAAAGAAACAAAAACGCCTGTTTCCCAGCAGTGGTTCGGTATTTTACCCTATGGCTTCCGACTTTGGCTGAAACGGAAAAAATAA |
| Sequence | MKTNDYVKYMTQQFVKYIDTPRDERKERKEVRKETKTPVSQQWFGILPYGFRLWLKRKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14038. Profile Description: YqzE-like protein. The YqzE-like protein family includes the B. subtilis YqzE protein, which is functionally uncharacterized. It is a part of the ComG operon, which is regulated by the competence transcription factor ComK. This family of proteins is found in bacteria. Proteins in this family are typically between 49 and 66 amino acids in length. |
| Pubmed ID | 9384377 19383706 |
| Domain | CDD:372887 |
| Functional Category | Others |
| Uniprot ID | O32020 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2555887 | 2556066 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2430076 | 2430255 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2353116 | 2353295 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 2415646 | 2415825 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3701275 | 3701454 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2428839 | 2429018 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 1491950 | 1492129 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 2507827 | 2508006 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2525058 | 2525237 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 10 | 2250139 | 2250339 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 3124945 | 3125133 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 3036546 | 3036740 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 4258624 | 4258809 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 14 | 2707299 | 2707481 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 2553938 | 2554120 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 2829159 | 2829341 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 17 | 3289104 | 3289298 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 18 | 3014950 | 3015132 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 3738818 | 3738997 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 20 | 1375263 | 1375469 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 5207284 | 5207472 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 22 | 3442330 | 3442506 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 23 | 1664719 | 1664895 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 24 | 2054347 | 2054526 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 25 | 3387413 | 3387601 | - | NZ_CP053989.1 | Niallia circulans |
| 26 | 1900328 | 1900516 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 27 | 1985953 | 1986132 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 28 | 2459112 | 2459291 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 29 | 1661464 | 1661643 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 30 | 1476412 | 1476591 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 31 | 3479046 | 3479225 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14173.8 | 0.97 | 30 | 72.0 | same-strand | ComG operon protein 7 |
| 2 | PF15980.7 | 0.9 | 28 | 454.0 | same-strand | Putative Competence protein ComGF |
| 3 | PF07963.14 | 0.97 | 30 | 1569 | same-strand | Prokaryotic N-terminal methylation motif |
++ More..