Result : O32015
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2507020 |
| Right | 2507256 |
| Strand | + |
| Nucleotide Sequence | ATGAGCCGACTTCTTGCGCTTTTAATATTAGTCATCCCCGGGGCTATTTCTGCTTTAGGCATTAAACTGATGAGAGATACACTTTTCGGCCATACAATCAAGCCATTTTCAGCTCTTTGGCTCCAAGGGTTGTCAGGATTCATCTTTTTTGCGATCGGCCTCTATGTGCTGGCCGGGTTCATTTTATACAGAGACAGAAAACGCAATCAAGTCAGCCCGCGATTCAGAAAACGATAG |
| Sequence | MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLSGFIFFAIGLYVLAGFILYRDRKRNQVSPRFRKR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11118. Profile Description: Protein of unknown function (DUF2627). This family is conserved in the Bacillaceae family. Several members are named as YqzF. The function is not known. |
| Pubmed ID | 9384377 |
| Domain | CDD:378560 |
| Functional Category | Others |
| Uniprot ID | O32015 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2507020 | 2507256 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2381096 | 2381332 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2470593 | 2470826 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2303925 | 2304167 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 2366651 | 2366887 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2379891 | 2380127 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 3750224 | 3750466 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1543597 | 1543839 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2456128 | 2456370 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2661582 | 2661836 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2508222 | 2508476 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2784834 | 2785088 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 3165787 | 3166023 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 3077265 | 3077501 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 2209399 | 2209635 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 1991373 | 1991630 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 17 | 1520157 | 1520405 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 3332273 | 3332521 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 19 | 2929909 | 2930142 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 20 | 1538655 | 1538861 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 1782841 | 1783077 | - | NZ_LS483476.1 | Lederbergia lentus |
| 22 | 2183930 | 2184166 | + | NZ_CP012024.1 | Bacillus smithii |
| 23 | 1705214 | 1705456 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 24 | 2416687 | 2416935 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 25 | 1617261 | 1617509 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 26 | 3540286 | 3540534 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 1916778 | 1917020 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 28 | 867062 | 867310 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 29 | 1862182 | 1862436 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 30 | 1551187 | 1551423 | - | NZ_CP059540.1 | Planococcus maritimus |
| 31 | 1540930 | 1541166 | - | NZ_CP016538.2 | Planococcus maritimus |
| 32 | 1294828 | 1295064 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 33 | 1706658 | 1706891 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 34 | 5157946 | 5158182 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 35 | 1577653 | 1577889 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 36 | 1495244 | 1495477 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 37 | 1550269 | 1550502 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 38 | 2438383 | 2438622 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 39 | 189349 | 189582 | + | NZ_CP013661.2 | Planococcus kocurii |
| 40 | 1593064 | 1593297 | - | NZ_CP019401.1 | Planococcus faecalis |
| 41 | 4172367 | 4172600 | + | NC_011725.1 | Bacillus cereus B4264 |
| 42 | 82397 | 82639 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 43 | 3586778 | 3587017 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 44 | 1699552 | 1699785 | + | NZ_CP016540.2 | Planococcus versutus |
| 45 | 4176028 | 4176261 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 46 | 2656542 | 2656778 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 47 | 1192634 | 1192867 | - | NZ_CP040336.1 | Bacillus luti |
| 48 | 4171420 | 4171671 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 49 | 3684338 | 3684586 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 50 | 1451499 | 1451744 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 51 | 1169352 | 1169558 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 52 | 620471 | 620707 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 53 | 4534776 | 4535012 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 54 | 4005879 | 4006112 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 55 | 4040617 | 4040850 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 56 | 1936180 | 1936422 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 57 | 683873 | 684115 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 58 | 3490670 | 3490903 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 59 | 1423423 | 1423656 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 60 | 3245462 | 3245722 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 61 | 1948244 | 1948483 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 62 | 1438857 | 1439102 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 63 | 136580 | 136774 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 64 | 2924956 | 2925192 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 65 | 2430688 | 2430933 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 66 | 2017285 | 2017500 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 67 | 2469001 | 2469237 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 68 | 2836363 | 2836599 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 69 | 1837365 | 1837601 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 70 | 1827310 | 1827546 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 71 | 3282889 | 3283125 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 72 | 3538089 | 3538340 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 73 | 1024125 | 1024361 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 74 | 2981047 | 2981286 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017786.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.97 | 71 | 5520.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF02852.24 | 0.97 | 71 | 5520.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 3 | PF02812.20 | 0.97 | 71 | 3266.0 | opposite-strand | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
| 4 | PF00158.28 | 0.9 | 66 | 150 | opposite-strand | Sigma-54 interaction domain |
| 5 | PF00989.27 | 0.9 | 66 | 150 | opposite-strand | PAS fold |
| 6 | PF13426.9 | 0.9 | 66 | 150 | opposite-strand | PAS domain |
| 7 | PF14532.8 | 0.9 | 66 | 150 | opposite-strand | Sigma-54 interaction domain |
| 8 | PF08448.12 | 0.9 | 66 | 150 | opposite-strand | PAS fold |
| 9 | PF02954.21 | 0.92 | 67 | 150.5 | opposite-strand | Bacterial regulatory protein, Fis family |
| 10 | PF00004.31 | 0.88 | 64 | 150 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 11 | PF07728.16 | 0.84 | 61 | 150.0 | opposite-strand | AAA domain (dynein-related subfamily) |
| 12 | PF00070.29 | 0.73 | 53 | 5568.0 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 13 | PF08769.13 | 0.73 | 53 | 1465.0 | opposite-strand | Sporulation initiation factor Spo0A C terminal |
| 14 | PF00072.26 | 0.68 | 50 | 1451 | opposite-strand | Response regulator receiver domain |
++ More..