Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YqzH |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2465966 |
Right | 2466172 |
Strand | + |
Nucleotide Sequence | ATGGAGAAATTTGTCGAAAAAATGCTGGGACAGGCATTGCGGCAATACGGCAGAAACGTTGCTATAGATCCGTTAAGCCCGTATGAAAAACAAAGCCTGAAAGCGGCTCTACAAGAGAGACGGAATGAAGAACCAGATGAGGATTTGCATGCGCATATAGAAGATATCATTTATGACTATGTCACAAACCAAGGCCTGTTCTCTTAA |
Sequence | MEKFVEKMLGQALRQYGRNVAIDPLSPYEKQSLKAALQERRNEEPDEDLHAHIEDIIYDYVTNQGLFS |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14164. Profile Description: YqzH-like protein. The YqzH-like protein family includes the B. subtilis YqzH protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. |
Pubmed ID | 9384377 |
Domain | CDD:372939 |
Functional Category | Others |
Uniprot ID | O32014 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2465966 | 2466172 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2428350 | 2428556 | + | NZ_CP033052.1 | Bacillus vallismortis |
3 | 2325799 | 2326005 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 2338801 | 2339007 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 2262257 | 2262463 | + | NZ_CP051464.1 | Bacillus mojavensis |
6 | 3791934 | 3792140 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 2338875 | 2339081 | + | NZ_CP048852.1 | Bacillus tequilensis |
8 | 1651722 | 1651928 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 2348035 | 2348241 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2680023 | 2680208 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 2557843 | 2558031 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 2457078 | 2457266 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04229.16 | 0.75 | 9 | 2742 | opposite-strand | GrpB protein |
2 | PF13508.9 | 0.75 | 9 | 2738.5 | opposite-strand | Acetyltransferase (GNAT) domain |
3 | PF03992.18 | 0.75 | 9 | 2407 | opposite-strand | Antibiotic biosynthesis monooxygenase |
4 | PF00583.27 | 0.75 | 9 | 1924 | opposite-strand | Acetyltransferase (GNAT) family |
5 | PF08863.12 | 1.0 | 12 | 1403.0 | opposite-strand | YolD-like protein |
6 | PF00817.22 | 1.0 | 12 | 168.5 | opposite-strand | impB/mucB/samB family |
7 | PF11799.10 | 1.0 | 12 | 168.5 | opposite-strand | impB/mucB/samB family C-terminal domain |
8 | PF00903.27 | 0.83 | 10 | 1686.0 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
9 | PF13669.8 | 0.92 | 11 | 1863 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
10 | PF11798.10 | 0.67 | 8 | 298.5 | opposite-strand | IMS family HHH motif |