Protein name |
Spore germination protein-like protein YpzD |
NCBI Accession ID |
AL009126.3 |
Organism |
Bacillus subtilis (strain 168) |
Left |
2435012 |
Right |
2435224 |
Strand |
+ |
Nucleotide Sequence |
ATGATTGATTATCCTATTAATATAAACAACGTTTCCGGGAACAGTGTAATTAACGTAGGCGGCGCTTTTATGATCAGGCCTTTAACTTTGTCCAAATCTGTGTTTGGCTCCGGAGGTTTAAACACAGGAATTGTCTTTGAAAATAACTTTGTAAGCAAAGCTAAAATGATTAATCATCAATTTACTGATCAAAACGTCACCAAAACTTTTTAA |
Sequence |
MIDYPININNVSGNSVINVGGAFMIRPLTLSKSVFGSGGLNTGIVFENNFVSKAKMINHQFTDQNVTKTF |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of pfam10676. Profile Description: Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor. |
Pubmed ID |
9384377
|
Domain |
CDD:371190 |
Functional Category |
Others |
Uniprot ID |
O32013
|
ORF Length (Amino Acid) |
70 |