Result : O32013
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore germination protein-like protein YpzD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2435012 |
| Right | 2435224 |
| Strand | + |
| Nucleotide Sequence | ATGATTGATTATCCTATTAATATAAACAACGTTTCCGGGAACAGTGTAATTAACGTAGGCGGCGCTTTTATGATCAGGCCTTTAACTTTGTCCAAATCTGTGTTTGGCTCCGGAGGTTTAAACACAGGAATTGTCTTTGAAAATAACTTTGTAAGCAAAGCTAAAATGATTAATCATCAATTTACTGATCAAAACGTCACCAAAACTTTTTAA |
| Sequence | MIDYPININNVSGNSVINVGGAFMIRPLTLSKSVFGSGGLNTGIVFENNFVSKAKMINHQFTDQNVTKTF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10676. Profile Description: Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor. |
| Pubmed ID | 9384377 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | O32013 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2435012 | 2435224 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2307902 | 2308114 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2468855 | 2469067 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 4 | 2468517 | 2468729 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 5 | 1530893 | 1531105 | - | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 1531231 | 1531443 | - | NZ_CP011937.1 | Bacillus velezensis |
++ More..