Result : O32007
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YpzA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2308495 |
| Right | 2308764 |
| Strand | + |
| Nucleotide Sequence | GTGACTTCAGAATTTCATAATGAGGATCAGACCGGCTTTACGGATAAGCGGCAGCTGGAACTAGCGGTGGAAACAGCGCAGAAAACAACAGGAGCCGCGACGAGAGGCCAAAGCAAAACATTAGTCGACTCTGCATACCAAGCCATTGAGGATGCTAGAGAACTGTCACAATCTGAAGAGCTGGCAGCTCTCGATGATCCTGAATTTGTAAAGCAGCAACAGCAGCTGCTAGATGACAGCGAGCATCAGCTGGATGAATTCAAAGAATAA |
| Sequence | MTSEFHNEDQTGFTDKRQLELAVETAQKTTGAATRGQSKTLVDSAYQAIEDARELSQSEELAALDDPEFVKQQQQLLDDSEHQLDEFKE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10819. Profile Description: Protein of unknown function (DUF2564). This family of proteins with unknown function appears to be restricted to Bacillus spp. |
| Pubmed ID | 9384377 |
| Domain | CDD:287756 |
| Functional Category | Others |
| Uniprot ID | O32007 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2308495 | 2308764 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2185560 | 2185829 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2264105 | 2264374 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3947896 | 3948165 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 2106400 | 2106669 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2117622 | 2117891 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 2177767 | 2178036 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 2150320 | 2150577 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1805425 | 1805682 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2384924 | 2385190 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2283550 | 2283816 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2490940 | 2491206 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00255.21 | 0.75 | 9 | 3460 | opposite-strand | Glutathione peroxidase |
| 2 | PF00578.23 | 0.75 | 9 | 3460 | opposite-strand | AhpC/TSA family |
| 3 | PF04204.18 | 0.92 | 11 | 2208 | same-strand | Homoserine O-succinyltransferase |
| 4 | PF06925.13 | 1.0 | 12 | 830.5 | same-strand | Monogalactosyldiacylglycerol (MGDG) synthase |
| 5 | PF00534.22 | 1.0 | 12 | 830.5 | same-strand | Glycosyl transferases group 1 |
| 6 | PF04101.18 | 1.0 | 12 | 830.5 | same-strand | Glycosyltransferase family 28 C-terminal domain |
| 7 | PF13692.8 | 1.0 | 12 | 830.5 | same-strand | Glycosyl transferases group 1 |
| 8 | PF00313.24 | 1.0 | 12 | 390.0 | same-strand | 'Cold-shock' DNA-binding domain |
| 9 | PF10782.11 | 1.0 | 12 | 29.0 | opposite-strand | Zinc-finger |
| 10 | PF13456.8 | 1.0 | 12 | 966.5 | both-strands | Reverse transcriptase-like |
| 11 | PF02592.17 | 1.0 | 12 | 1001.0 | same-strand | Putative vitamin uptake transporter |
| 12 | PF00075.26 | 1.0 | 12 | 1654.0 | same-strand | RNase H |
++ More..