Result : A2BYT4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP000552.1 |
| Organism | Prochlorococcus marinus (strain MIT 9515) |
| Left | 1527575 |
| Right | 1527877 |
| Strand | - |
| Nucleotide Sequence | ATGAGTAAATTATTTGAGTCTCGTTTAGCAGATGTAATTCGTAAGCCCGTCATTACAGAAAAAGCGACAAATGCACTAGACCTTAATCAATATACTTTTGAGGTAGATCATAGAGCGGCAAAGCCTCAAATCAAGGCAGCAATAGAGGCCTTGTTTAATGTTAAAGTTATAGGAATAAACACTATGAATCCTCCTAGGAGAACAAGAAGAGTCGGTAAATTCTCCGGAAAACGTTCTCAAGTCAAAAAGGCAATTGTACGTCTTGCTGAAGGAGACAAAATCCAACTATTCCCAGAATCTTAA |
| Sequence | MSKLFESRLADVIRKPVITEKATNALDLNQYTFEVDHRAAKPQIKAAIEALFNVKVIGINTMNPPRRTRRVGKFSGKRSQVKKAIVRLAEGDKIQLFPES |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 18159947 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A2BYT4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 283
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1563310 | 1563618 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 1754483 | 1754785 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 3 | 5186502 | 5186804 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 4 | 64562 | 64855 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 5 | 6281085 | 6281393 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 6 | 5542443 | 5542694 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 7 | 4730516 | 4730818 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 8 | 3735235 | 3735501 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 9 | 3390650 | 3390925 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 10 | 66675 | 66977 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 11 | 87625 | 87927 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 12 | 5494994 | 5495317 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 13 | 2621637 | 2621903 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 14 | 4465576 | 4465818 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 15 | 1921217 | 1921519 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 16 | 5624325 | 5624603 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 17 | 6145158 | 6145472 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 18 | 648217 | 648474 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 19 | 2167660 | 2167974 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 20 | 3996766 | 3997080 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 21 | 5465402 | 5465716 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 22 | 4584037 | 4584315 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 23 | 6464847 | 6465161 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 24 | 2665476 | 2665754 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 25 | 3762255 | 3762509 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 26 | 177537 | 177779 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 27 | 5290684 | 5290935 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 28 | 220535 | 220798 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 29 | 4137079 | 4137411 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 30 | 2590688 | 2590981 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 31 | 1888855 | 1889100 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 32 | 2473881 | 2474183 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 33 | 74641 | 74943 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 34 | 1963924 | 1964181 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 35 | 40427 | 40672 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 36 | 2225113 | 2225358 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 37 | 2132821 | 2133072 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 38 | 3260154 | 3260423 | + | NZ_CP019948.1 | Methylocystis bryophila |
| 39 | 3679500 | 3679763 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 40 | 4212092 | 4212349 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 41 | 3722124 | 3722414 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 42 | 289765 | 290037 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 43 | 1405097 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 44 | 2938514 | 2938774 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 45 | 6468066 | 6468326 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 46 | 3277521 | 3277844 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 47 | 3303108 | 3303431 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 48 | 5201607 | 5201930 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 49 | 2355811 | 2356083 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 50 | 4613686 | 4614009 | - | NZ_CP070326.1 | Streptomyces noursei |
| 51 | 2079049 | 2079306 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 52 | 2770704 | 2770964 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 53 | 4881421 | 4881753 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 54 | 4642927 | 4643187 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 55 | 2158615 | 2158872 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 56 | 4745888 | 4746220 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 57 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 58 | 921547 | 921825 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 59 | 418304 | 418600 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 60 | 535803 | 536060 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 61 | 466712 | 466984 | - | NZ_CP068419.1 | Gluconobacter sphaericus |
| 62 | 2973315 | 2973608 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 63 | 2663366 | 2663620 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 64 | 2496256 | 2496546 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 65 | 2472316 | 2472573 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 66 | 101752 | 102018 | + | NZ_CP017326.1 | Weissella soli |
| 67 | 33810 | 34076 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 68 | 5223954 | 5224238 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 69 | 3905865 | 3906188 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 70 | 4067757 | 4068080 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 71 | 2814163 | 2814423 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 72 | 414713 | 414970 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 73 | 1811461 | 1811727 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 74 | 778019 | 778297 | - | NZ_CP029352.1 | Azospirillum thermophilum |
| 75 | 4776789 | 4777046 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 76 | 3874523 | 3874783 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 77 | 3500636 | 3500896 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 78 | 201687 | 201932 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 79 | 392960 | 393241 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 80 | 4053982 | 4054296 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 81 | 442837 | 443094 | + | NZ_CP021081.1 | Deinococcus ficus |
| 82 | 675479 | 675736 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 83 | 361694 | 361951 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 84 | 1748623 | 1748898 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 85 | 280312 | 280605 | + | NZ_CP014204.2 | Clostridium baratii |
| 86 | 56572 | 56862 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 87 | 287869 | 288150 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 88 | 6062991 | 6063248 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 89 | 1172413 | 1172703 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 90 | 1149394 | 1149675 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 91 | 1952522 | 1952803 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 92 | 860098 | 860379 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 93 | 223296 | 223577 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 94 | 70754 | 71044 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 95 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 96 | 307992 | 308258 | + | NZ_CP027563.1 | Weissella confusa |
| 97 | 2677191 | 2677448 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 98 | 65946 | 66236 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 99 | 507173 | 507463 | - | NZ_LR134293.1 | Streptococcus canis |
| 100 | 71448 | 71738 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 101 | 2167442 | 2167738 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 102 | 1957911 | 1958183 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 103 | 3873688 | 3873948 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 104 | 305569 | 305823 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 105 | 158207 | 158455 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 106 | 7502687 | 7502944 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 107 | 2640233 | 2640562 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 108 | 158568 | 158837 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 109 | 63612 | 63854 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 110 | 70719 | 70961 | + | NZ_CP065211.1 | Enterococcus lactis |
| 111 | 588902 | 589144 | - | NZ_CP023011.2 | Enterococcus hirae |
| 112 | 3158974 | 3159216 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 113 | 236814 | 237101 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 114 | 59994 | 60251 | - | NZ_CP060244.1 | Entomobacter blattae |
| 115 | 2248788 | 2249045 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 116 | 1283016 | 1283303 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 117 | 2076788 | 2077045 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 118 | 233484 | 233738 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 119 | 3482432 | 3482707 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 120 | 3966086 | 3966409 | - | NZ_CP023691.1 | Streptomyces platensis |
| 121 | 490459 | 490752 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 122 | 844338 | 844631 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 123 | 2583942 | 2584247 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 124 | 2971183 | 2971437 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 125 | 4957820 | 4958080 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 126 | 1209996 | 1210304 | - | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 127 | 77694 | 77984 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 128 | 3214497 | 3214820 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 129 | 3729019 | 3729276 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 130 | 73715 | 74008 | + | NC_012924.1 | Streptococcus suis SC84 |
| 131 | 356056 | 356334 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 132 | 1155365 | 1155622 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 133 | 2284596 | 2284853 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 134 | 82599 | 82889 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 135 | 4723912 | 4724214 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 136 | 1053861 | 1054169 | + | NZ_CP025198.1 | Acidipropionibacterium virtanenii |
| 137 | 106607 | 106900 | + | NZ_LS483343.1 | Streptococcus ferus |
| 138 | 616424 | 616747 | + | NZ_CP030862.1 | Streptomyces globosus |
| 139 | 315701 | 315979 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 140 | 2478925 | 2479203 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 141 | 1364360 | 1364641 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 142 | 1217600 | 1217881 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 143 | 1029518 | 1029799 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 144 | 2447466 | 2447747 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 145 | 2564479 | 2564754 | + | NZ_CP060713.1 | Nocardioides mesophilus |
| 146 | 2071902 | 2072189 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 147 | 4290078 | 4290347 | - | NZ_CP010803.1 | Martelella endophytica |
| 148 | 244730 | 245014 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 149 | 92704 | 92994 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 150 | 814083 | 814364 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 151 | 1670710 | 1671003 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 152 | 6594835 | 6595089 | - | NZ_CP029550.1 | Methylobacterium durans |
| 153 | 5377763 | 5378086 | + | NZ_CP027306.1 | Streptomyces atratus |
| 154 | 63661 | 63951 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 155 | 1842196 | 1842486 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 156 | 1860373 | 1860663 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 157 | 2547717 | 2547986 | + | NZ_CP032509.1 | Georhizobium profundi |
| 158 | 3565616 | 3565870 | - | NZ_CP041636.1 | Ferrovibrio terrae |
| 159 | 4257363 | 4257632 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 160 | 3052549 | 3052872 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 161 | 1089030 | 1089284 | - | NZ_CP053923.1 | Defluviicoccus vanus |
| 162 | 2209418 | 2209687 | + | NZ_CP039546.1 | Methylorubrum populi |
| 163 | 821560 | 821898 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 164 | 4849289 | 4849549 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 165 | 2013083 | 2013337 | + | NZ_CP061205.1 | Kordiimonas pumila |
| 166 | 825532 | 825819 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 167 | 2740463 | 2740750 | - | NC_017790.1 | Deinococcus gobiensis I-0 |
| 168 | 1750033 | 1750326 | + | NZ_CP013237.1 | Streptococcus mutans |
| 169 | 1915469 | 1915762 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 170 | 3128189 | 3128512 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 171 | 220426 | 220668 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 172 | 2427648 | 2427956 | - | NZ_LR134406.1 | Arachnia propionica |
| 173 | 72747 | 73037 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 174 | 871340 | 871630 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 175 | 4172529 | 4172798 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 176 | 874574 | 874873 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 177 | 669517 | 669807 | + | NZ_CP043405.1 | Streptococcus ratti |
| 178 | 1734517 | 1734786 | + | NZ_CP020906.1 | Rhizobium etli |
| 179 | 1738311 | 1738580 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 180 | 2632256 | 2632525 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 181 | 1782826 | 1783095 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 182 | 1783815 | 1784084 | + | NZ_CP071604.1 | Rhizobium binae |
| 183 | 3614832 | 3615101 | + | NZ_CP071454.1 | Rhizobium lentis |
| 184 | 1778813 | 1779082 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 185 | 1349248 | 1349517 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 186 | 785086 | 785355 | - | NZ_CP054021.1 | Rhizobium indicum |
| 187 | 2015758 | 2016027 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 188 | 68110 | 68352 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 189 | 4874520 | 4874780 | + | NZ_CP070242.1 | Streptomyces californicus |
| 190 | 4934323 | 4934583 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 191 | 3560170 | 3560487 | - | NC_016109.1 | Kitasatospora setae KM-6054 |
| 192 | 451309 | 451599 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 193 | 2177093 | 2177362 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 194 | 3930227 | 3930523 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 195 | 1236236 | 1236535 | - | NZ_CP007490.1 | Rhodoluna lacicola |
| 196 | 234814 | 235056 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 197 | 2167085 | 2167372 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 198 | 1081887 | 1082165 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 199 | 1583423 | 1583692 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 200 | 3436645 | 3436896 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 201 | 3269677 | 3269919 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 202 | 1487083 | 1487373 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 203 | 1522677 | 1522946 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 204 | 108114 | 108404 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 205 | 675278 | 675544 | - | NZ_CP041659.1 | Sphingomonas xanthus |
| 206 | 2660564 | 2660851 | - | NZ_HG917868.1 | Clostridium bornimense |
| 207 | 3332785 | 3333045 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 208 | 1509065 | 1509319 | + | NZ_CP012946.1 | Blastochloris viridis |
| 209 | 2069083 | 2069352 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 210 | 2808126 | 2808395 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 211 | 4650371 | 4650631 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 212 | 192357 | 192599 | + | NZ_CP043998.1 | Clostridium diolis |
| 213 | 1298759 | 1299028 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 214 | 1801562 | 1801813 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 215 | 919284 | 919538 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 216 | 944614 | 944883 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 217 | 1644631 | 1644915 | - | NZ_LR134404.1 | Weeksella virosa |
| 218 | 2411393 | 2411674 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 219 | 1322075 | 1322344 | + | NZ_CP019044.1 | Salaquimonas pukyongi |
| 220 | 3935622 | 3935864 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 221 | 2402719 | 2402994 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 222 | 345059 | 345313 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 223 | 2021052 | 2021324 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 224 | 1915092 | 1915346 | - | NZ_AP018907.1 | Blastochloris tepida |
| 225 | 3350324 | 3350566 | - | NZ_CP040924.1 | Clostridium thermarum |
| 226 | 647364 | 647645 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 227 | 274358 | 274627 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 228 | 2190992 | 2191261 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 229 | 3007152 | 3007421 | - | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 230 | 4314348 | 4314662 | - | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 231 | 252874 | 253161 | + | NZ_CP016786.1 | Clostridium isatidis |
| 232 | 659869 | 660138 | + | NZ_CP004393.1 | Celeribacter indicus |
| 233 | 692512 | 692754 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 234 | 2977497 | 2977751 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 235 | 4354252 | 4354521 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 236 | 3193963 | 3194238 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 237 | 237226 | 237516 | + | NC_008593.1 | Clostridium novyi NT |
| 238 | 1129090 | 1129377 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 239 | 1454127 | 1454414 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 240 | 2600986 | 2601255 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 241 | 551340 | 551642 | + | NZ_CP017812.1 | Boudabousia tangfeifanii |
| 242 | 1801019 | 1801288 | - | NZ_CP045072.1 | Paracoccus kondratievae |
| 243 | 884506 | 884805 | - | NZ_CP035806.1 | Leucobacter triazinivorans |
| 244 | 2015822 | 2016076 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 245 | 280772 | 281041 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 246 | 628309 | 628578 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 247 | 212713 | 212982 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 248 | 384376 | 384663 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 249 | 239578 | 239865 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 250 | 1666524 | 1666793 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 251 | 1611256 | 1611525 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 252 | 3260460 | 3260714 | + | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 253 | 647296 | 647565 | - | NZ_CP024422.1 | Paracoccus yeei |
| 254 | 4477392 | 4477661 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 255 | 2764652 | 2764915 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 256 | 1124693 | 1124962 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 257 | 3145188 | 3145457 | - | NZ_CP010650.1 | Phaeobacter inhibens |
| 258 | 1018793 | 1019092 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
| 259 | 771258 | 771527 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 260 | 3707271 | 3707540 | - | NZ_CP019437.1 | Thioclava nitratireducens |
| 261 | 128034 | 128303 | + | NZ_CP032125.1 | Profundibacter amoris |
| 262 | 395073 | 395342 | + | NZ_CP016364.1 | Phaeobacter porticola |
| 263 | 215159 | 215401 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 264 | 3439202 | 3439471 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 265 | 230706 | 230975 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 266 | 238661 | 238945 | + | NC_013515.1 | Streptobacillus moniliformis DSM 12112 |
| 267 | 3837143 | 3837412 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 268 | 1317771 | 1318040 | + | NZ_CP030918.1 | Paracoccus suum |
| 269 | 854006 | 854275 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 270 | 297618 | 297887 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 271 | 864506 | 864775 | - | NZ_CP015093.1 | Salipiger abyssi |
| 272 | 4157491 | 4157781 | + | NZ_CP025791.1 | Flavivirga eckloniae |
| 273 | 1532284 | 1532553 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 274 | 3257118 | 3257417 | + | NZ_CP049863.1 | Leucobacter viscericola |
| 275 | 209346 | 209615 | + | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 276 | 1456642 | 1456884 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 277 | 1594779 | 1595051 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 278 | 762765 | 763007 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 279 | 249118 | 249414 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 280 | 248037 | 248306 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 281 | 598256 | 598525 | + | NZ_CP048788.1 | Roseobacter ponti |
| 282 | 1661897 | 1662157 | + | NZ_CP041694.1 | Cellulosimicrobium cellulans |
| 283 | 990787 | 991098 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 284 | 2422864 | 2423145 | - | NZ_CP021255.1 | Desulfobulbus oralis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019309.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.91 | 257 | 2316 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 0.95 | 269 | 1577 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 0.95 | 269 | 1577 | same-strand | KH domain |
| 4 | PF00237.21 | 0.96 | 272 | 1214.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 0.96 | 273 | 898 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 0.96 | 273 | 34 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 0.96 | 273 | 34 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 1.0 | 283 | 24 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 0.89 | 252 | 1385.0 | same-strand | Ribosomal protein S10p/S20e |
++ More..