Result : O31984
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived protein BhlB |
| NCBI Accession ID | AF021803.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1846 |
| Right | 2112 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGAGAATATTGATAAAGGCACAATTGTTAGGACTCTTTTGCTCGCAATAGCTTTACTCAATCAAATAATGGTGATGCTGGGTAAAGCAGCATTCATCATTAACGAAGAGGACATAAATCATTTATATGATTGTTTATATACAATTTTCACTATCGTCTTCACAACCAGTACTACTACCGCAGCATGGTTCAAAAACAATTACATAACTGCAAAAGGAAAAAAACAAAAACAAGTTCTAAAAAAAGAGAACTTGTTTAAATAG |
| Sequence | MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTTTAAWFKNNYITAKGKKQKQVLKKENLFK |
| Source of smORF | Swiss-Prot |
| Function | May be involved in the secretion of the autolysin BlyA. |
| Pubmed ID | 9579063 9384377 |
| Domain | CDD:420075 |
| Functional Category | Others |
| Uniprot ID | O31984 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2264903 | 2265169 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1347049 | 1347276 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1263125 | 1263343 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1969589 | 1969852 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1316907 | 1317125 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1320462 | 1320680 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 2703184 | 2703447 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 1355799 | 1356017 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 9 | 1516083 | 1516301 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 10 | 638694 | 638912 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 11 | 2611933 | 2612196 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 1001092 | 1001319 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 3369076 | 3369303 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 1402414 | 1402641 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 1459902 | 1460129 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 3433370 | 3433597 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 17 | 3841512 | 3841739 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 18 | 3208457 | 3208684 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 19 | 1375193 | 1375456 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 20 | 2810430 | 2810663 | + | NZ_CP053989.1 | Niallia circulans |
| 21 | 2441333 | 2441566 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 22 | 2498652 | 2498885 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 23 | 2691078 | 2691296 | - | NZ_CP011937.1 | Bacillus velezensis |
| 24 | 1269957 | 1270175 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01510.27 | 0.8 | 12 | 14 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 2 | PF09693.12 | 0.67 | 10 | 795.5 | same-strand | Phage uncharacterised protein (Phage XkdX) |
| 3 | PF10779.11 | 0.87 | 13 | 54.0 | same-strand | Haemolysin XhlA |
| 4 | PF01476.22 | 0.8 | 12 | 14 | same-strand | LysM domain |
| 5 | PF01471.20 | 0.87 | 13 | 27.0 | same-strand | Putative peptidoglycan binding domain |
| 6 | PF14185.8 | 0.6 | 9 | 1165 | opposite-strand | Antitoxin SpoIISB, type II toxin-antitoxin system |
| 7 | PF14171.8 | 0.6 | 9 | 1335 | opposite-strand | Toxin SpoIISA, type II toxin-antitoxin system |
++ More..