Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived protein BhlA |
NCBI Accession ID | AF021803.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 1623 |
Right | 1835 |
Strand | + |
Nucleotide Sequence | ATGGAAATGGATATAACACAATATTTAAGTACCCAGGGGCCATTTGCTGTTTTATTTTGTTGGCTACTTTTCTACGTAATGAAAACTAGTAAGGAAAGAGAGTCGAAACTTTATAATCAAATCGATTCTCAAAACGAAGTACTGGGTAAATTCAGTGAAAAGTACGATGTTGTAATTGAAAAGCTAGATAAAATCGAACAAAATTTTAAGTAG |
Sequence | MEMDITQYLSTQGPFAVLFCWLLFYVMKTSKERESKLYNQIDSQNEVLGKFSEKYDVVIEKLDKIEQNFK |
Source of smORF | Swiss-Prot |
Function | May be involved in the secretion of the autolysin BlyA. |
Pubmed ID | 9579063 9384377 |
Domain | CDD:402508 |
Functional Category | Others |
Uniprot ID | O31983 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2264680 | 2264892 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2703462 | 2703674 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1969865 | 1970077 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 2791666 | 2791878 | - | NZ_CP011150.1 | Bacillus altitudinis |
5 | 1204290 | 1204502 | + | NZ_CP011150.1 | Bacillus altitudinis |
6 | 2519143 | 2519355 | + | NZ_CP043404.1 | Bacillus safensis |
7 | 1547188 | 1547394 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
8 | 1537676 | 1537879 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
9 | 199901 | 200119 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
10 | 1097728 | 1097940 | + | NZ_CP053989.1 | Niallia circulans |
11 | 4057098 | 4057286 | - | NZ_CP009288.1 | Paenibacillus durus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01510.27 | 0.8 | 8 | 296 | same-strand | N-acetylmuramoyl-L-alanine amidase |
2 | PF04688.15 | 0.6 | 6 | 13 | same-strand | SPP1 phage holin |
3 | PF09693.12 | 0.7 | 7 | 62 | same-strand | Phage uncharacterised protein (Phage XkdX) |