Result : O31968
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YomP |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2243989 |
| Right | 2244180 |
| Strand | + |
| Nucleotide Sequence | ATGAGCAATTTTTGGGTTATAGCCCTAAACAAAAACTGGGCAACTCTTGATCAGGTTAAAGAAGCTTATTATTACGATGATGTAACTAAGGAAGAACTCAAAGAAGGAGTAGACAATAACTTAATTACTCCTGAACAATATCAAGAAATTGTTGGGGAAGCCTATACTTCAGTTACCTTATCTACAGAATAA |
| Sequence | MSNFWVIALNKNWATLDQVKEAYYYDDVTKEELKEGVDNNLITPEQYQEIVGEAYTSVTLSTE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
| Pubmed ID | 9384377 |
| Domain | CDD:420140 |
| Functional Category | Others |
| Uniprot ID | O31968 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2243989 | 2244180 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2666884 | 2667048 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1345631 | 1345795 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 1536593 | 1536751 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 5 | 1514653 | 1514817 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1268598 | 1268765 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 1354370 | 1354534 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2692488 | 2692655 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 640176 | 640340 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 1319032 | 1319196 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 11 | 1315479 | 1315643 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01510.27 | 1.0 | 9 | 1494.5 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 2 | PF01471.20 | 0.89 | 8 | 1495 | same-strand | Putative peptidoglycan binding domain |
| 3 | PF09636.12 | 0.78 | 7 | -3.0 | same-strand | XkdW protein |
| 4 | PF10076.11 | 0.89 | 8 | 2693 | same-strand | Uncharacterised protein conserved in bacteria (DUF2313) |
| 5 | PF04865.16 | 0.89 | 8 | 3255 | same-strand | Baseplate J-like protein |
| 6 | PF10779.11 | 0.89 | 8 | 936.0 | same-strand | Haemolysin XhlA |
| 7 | PF04688.15 | 0.89 | 8 | 1219.0 | same-strand | SPP1 phage holin |
| 8 | PF01476.22 | 1.0 | 9 | 1495 | same-strand | LysM domain |
++ More..