Result : O31947

Protein Information

• Protein name: SPbeta prophage-derived uncharacterized protein YonK
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2227297
• Right: 2227488
• Strand: +
• Nucleotide Sequence: ATGGCAAGCAAAAAAGTACATCAAATTAATGTTAAAGGCTTTTTTGATATGGACGTAATGGAAGTTACTGAACAAACTAAAGAAGCTGAATACACATATGATTTCAAAGAAATTCTTTCAGAGTTTAATGGAAAAAATGTTTCAATTACTGTAAAAGAAGAAAATGAACTTCCTGTTAAAGGCGTTGAGTAA
• Sequence: MASKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam09642. Profile Description: YonK protein. YonK protein is expressed by the bacterial prophage SPbetaC. It is a 63 residue protein that associates into a homo-octamer in the form of a beta-stranded barrel with four outer helical features at points of the compass. Its function is unknown.
• Pubmed ID: 9384377
• Domain: CDD:401542
• Functional Category: Others
• Uniprot ID: O31947
• ORF Length (Amino Acid): 63

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2227297	2227488	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1939961	1940152	-	NZ_LT603683.1	Bacillus glycinifermentans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00216.23	1.0	2	2041.5	same-strand	Bacterial DNA-binding protein
2	PF13245.8	1.0	2	2903.5	same-strand	AAA domain