Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized protein YonK |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2227297 |
Right | 2227488 |
Strand | + |
Nucleotide Sequence | ATGGCAAGCAAAAAAGTACATCAAATTAATGTTAAAGGCTTTTTTGATATGGACGTAATGGAAGTTACTGAACAAACTAAAGAAGCTGAATACACATATGATTTCAAAGAAATTCTTTCAGAGTTTAATGGAAAAAATGTTTCAATTACTGTAAAAGAAGAAAATGAACTTCCTGTTAAAGGCGTTGAGTAA |
Sequence | MASKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam09642. Profile Description: YonK protein. YonK protein is expressed by the bacterial prophage SPbetaC. It is a 63 residue protein that associates into a homo-octamer in the form of a beta-stranded barrel with four outer helical features at points of the compass. Its function is unknown. |
Pubmed ID | 9384377 |
Domain | CDD:401542 |
Functional Category | Others |
Uniprot ID | O31947 |
ORF Length (Amino Acid) | 63 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2227297 | 2227488 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1939961 | 1940152 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00216.23 | 1.0 | 2 | 2041.5 | same-strand | Bacterial DNA-binding protein |
2 | PF13245.8 | 1.0 | 2 | 2903.5 | same-strand | AAA domain |