| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YonP |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2222340 |
| Right | 2222534 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAAGGATTCAGAGAAAGTAACGTACATGTTTAGTAATTTAATTGGATTTTTAGAGACTGCTATTATTGAAGGAACTGCTTCACAAGAAGAAAACACTCTTTATGAGGACTATAAACTATTTGGAACAATCGATAAAAAGAGCTATACATATAAAAATCTTGTACATAAGTATCTAAAAAGCGATTATTAA |
| Sequence | MQKDSEKVTYMFSNLIGFLETAIIEGTASQEENTLYEDYKLFGTIDKKSYTYKNLVHKYLKSDY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31944 |
| ORF Length (Amino Acid) | 64 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2222340 | 2222534 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1773923 | 1774117 | - | NZ_CP048852.1 | Bacillus tequilensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00216.23 | 1.0 | 2 | 3453.0 | same-strand | Bacterial DNA-binding protein |