Result : O31936

Protein Information

• Protein name: Putative antitoxin YopB (SPbeta prophage-derived protein YopB)
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2214972
• Right: 2215199
• Strand: -
• Nucleotide Sequence: ATGATTAGATCAAATTTAAAGTCCATAATAGACGAAAGAAAGATCAGTATCCGGAAGCTATCTAGAGATATTGATCATGAGTATCCAACTGTCAGAAAGCTTTATAATGACGAAATGGAGCGGTATCCAAGAGATCTGTTAGATAAAGTCTGTACATACCTAAACATCGAGCTGCAGGAATTGCTGATATTCGAAAAAAGCCATAACCATATCGATCACTCAGGATGA
• Sequence: MIRSNLKSIIDERKISIRKLSRDIDHEYPTVRKLYNDEMERYPRDLLDKVCTYLNIELQELLIFEKSHNHIDHSG
• Source of smORF: Swiss-Prot
• Function: May be the antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the activity of cognate toxin YopC. {ECO:0000305}.
• Pubmed ID: 9384377
• Domain: CDD:419869
• Functional Category: Antitoxin_type_2
• Uniprot ID: O31936
• ORF Length (Amino Acid): 75

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2214972	2215199	-	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1783163	1783390	+	NZ_CP048852.1	Bacillus tequilensis
3	2085823	2086050	-	NZ_CP048852.1	Bacillus tequilensis
4	1994825	1995052	-	NZ_CP013984.1	Bacillus inaquosorum
5	1958753	1958959	+	NZ_LT603683.1	Bacillus glycinifermentans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17094.7	0.75	3	1494	same-strand	Uncharacterised protein family (UPF0715)