Result : O31931
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YopG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2211884 |
| Right | 2212015 |
| Strand | - |
| Nucleotide Sequence | GTGTATTGGATAGAGTGGATTGAGAATGGAGAAAAGAAAAACATTGTTGCAGAAGGTTGGATTGAATGGGCTGCTATACTTGAAGACTTGTATCAGAAGCGGTTCGAGTATGTTGAATGGAAGCGGCTATAA |
| Sequence | MYWIEWIENGEKKNIVAEGWIEWAAILEDLYQKRFEYVEWKRL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31931 |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2211884 | 2212015 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1787604 | 1787738 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1991778 | 1991909 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1786550 | 1786657 | + | NZ_CP013984.1 | Bacillus inaquosorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17094.7 | 1.0 | 3 | 1068 | same-strand | Uncharacterised protein family (UPF0715) |
++ More..