Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized protein YopG |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2211884 |
Right | 2212015 |
Strand | - |
Nucleotide Sequence | GTGTATTGGATAGAGTGGATTGAGAATGGAGAAAAGAAAAACATTGTTGCAGAAGGTTGGATTGAATGGGCTGCTATACTTGAAGACTTGTATCAGAAGCGGTTCGAGTATGTTGAATGGAAGCGGCTATAA |
Sequence | MYWIEWIENGEKKNIVAEGWIEWAAILEDLYQKRFEYVEWKRL |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31931 |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2211884 | 2212015 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1787604 | 1787738 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 1991778 | 1991909 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 1786550 | 1786657 | + | NZ_CP013984.1 | Bacillus inaquosorum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17094.7 | 1.0 | 3 | 1068 | same-strand | Uncharacterised protein family (UPF0715) |