ProsmORF-pred
Result : O31926
Protein Information
Information Type Description
Protein name SPbeta prophage-derived uncharacterized protein YopL
NCBI Accession ID AL009126.3
Organism Bacillus subtilis (strain 168)
Left 2208855
Right 2208980
Strand -
Nucleotide Sequence ATGAAAAAACTTATTATGGCTTTAGTTATCTTGGGCGCACTAGGCACTTCTTACATAAGTGCAGATTCTTCAATCCAACAAGCTTCAGGTGATTATGAGGTTGCTGGAATGCCACGTGGAGCATAA
Sequence MKKLIMALVILGALGTSYISADSSIQQASGDYEVAGMPRGA
Source of smORF Swiss-Prot
Function The ORF matches to the profile of NF033802. Profile Description: lysogeny pheromone AimP family peptide. AimP is the quorum signaling-like peptide pheromone of a phage system, called the arbitrium system, that detects environmental evidence of predecessor phage activity, in order to direct a lysis/lysogeny decision.
Pubmed ID 9384377
Domain CDD:411382
Functional Category Others
Uniprot ID O31926
ORF Length (Amino Acid) 41
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2208855 2208980 - NC_000964.3 Bacillus subtilis subsp. subtilis str. 168
2 1790270 1790395 + NZ_CP048852.1 Bacillus tequilensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000964.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF14072.8 1.0 2 2283.5 same-strand DNA-sulfur modification-associated
2 PF00589.24 1.0 2 1100.5 same-strand Phage integrase family
3 PF01381.24 1.0 2 898.5 same-strand Helix-turn-helix
4 PF13443.8 1.0 2 898.5 same-strand Cro/C1-type HTH DNA-binding domain
5 PF12844.9 1.0 2 898.5 same-strand Helix-turn-helix domain
++ More..