Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized protein YoqX |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2191334 |
Right | 2191555 |
Strand | - |
Nucleotide Sequence | ATGCCGCAGCAAACAGTTGAGGTTAAAGAAGTTGATGTGTTGATTAGGGGAATATGGAGAAAGAAAAAGTTCACCGATATTCAAAAGGGGCAAACCTTTAAGATTGAGGAGAACGGAAGAACAAAGAAATACATAGCGAGAACAGATCCTTATTGGGATGACATGTTTGAAACTTACATTATTGATTTGTTGGATAAAAATAAAATTAGAAGAAATAAGTAA |
Sequence | MPQQTVEVKEVDVLIRGIWRKKKFTDIQKGQTFKIEENGRTKKYIARTDPYWDDMFETYIIDLLDKNKIRRNK |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31915 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2191334 | 2191555 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1804549 | 1804770 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 1981270 | 1981494 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02586.16 | 0.67 | 2 | 71.0 | opposite-strand | SOS response associated peptidase (SRAP) |
2 | PF01068.23 | 1.0 | 3 | 815 | opposite-strand | ATP dependent DNA ligase domain |