Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized protein YorO |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2174352 |
Right | 2174549 |
Strand | - |
Nucleotide Sequence | TTGAAGTGTATTCAAATTGAAATGTCATTCACAGACGAATATGGACAGGTGACCAGATTAAATAAGACTTATAAACCGTCGATTATTGAAGAACATAAAGGGGAAATCCCTAGATTGTTGCTAGATGATTTTAAGAGGTTCTTGTCGTCCCTTGGGTTTAATGAAAAACAGGTTTCGAGAATAGTAACAGAAGATTAA |
Sequence | MKCIQIEMSFTDEYGQVTRLNKTYKPSIIEEHKGEIPRLLLDDFKRFLSSLGFNEKQVSRIVTED |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31899 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2174352 | 2174549 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1819081 | 1819278 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13238.8 | 1.0 | 2 | 396.0 | same-strand | AAA domain |
2 | PF09629.12 | 1.0 | 2 | 33.0 | same-strand | YorP protein |
3 | PF06725.13 | 1.0 | 2 | 303.0 | same-strand | 3D domain |
4 | PF01368.22 | 1.0 | 2 | 4165.5 | same-strand | DHH family |
5 | PF17768.3 | 1.0 | 2 | 4165.5 | same-strand | RecJ OB domain |