Result : O31898
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YorP |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2174104 |
| Right | 2174319 |
| Strand | - |
| Nucleotide Sequence | TTGCCTAAATACTGGAGTTATCCTGTTGGACTAGCTGTAGAAATTAACAATAATGCACGATATGGATGCCCACATCATGTGGGGAGAAAAGGAAAGATTATCGAGCATTTACATTCAGCTACATATGACTATGCAGTTAGCGATGAAACAGGTGACATTACTTACTTTAAAGAACATGAATTAACACCACTAAAGGGAGGTTTAGCTTATGTTTAA |
| Sequence | MPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam09629. Profile Description: YorP protein. YorP is a 71 residue protein found in bacteria. As it is also found in a bacteriophage it might be of viral origin. The structure is of an alpha helix between two of five beta strands. The function is unknown. |
| Pubmed ID | 9384377 |
| Domain | CDD:401532 |
| Functional Category | Others |
| Uniprot ID | O31898 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2174104 | 2174319 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1819311 | 1819526 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13238.8 | 1.0 | 2 | 148.0 | same-strand | AAA domain |
| 2 | PF06725.13 | 1.0 | 2 | 533.0 | same-strand | 3D domain |
| 3 | PF01368.22 | 1.0 | 2 | 4395.5 | same-strand | DHH family |
| 4 | PF17768.3 | 1.0 | 2 | 4395.5 | same-strand | RecJ OB domain |
++ More..