ProsmORF-pred
Result : O31898
Protein Information
Information Type Description
Protein name SPbeta prophage-derived uncharacterized protein YorP
NCBI Accession ID AL009126.3
Organism Bacillus subtilis (strain 168)
Left 2174104
Right 2174319
Strand -
Nucleotide Sequence TTGCCTAAATACTGGAGTTATCCTGTTGGACTAGCTGTAGAAATTAACAATAATGCACGATATGGATGCCCACATCATGTGGGGAGAAAAGGAAAGATTATCGAGCATTTACATTCAGCTACATATGACTATGCAGTTAGCGATGAAACAGGTGACATTACTTACTTTAAAGAACATGAATTAACACCACTAAAGGGAGGTTTAGCTTATGTTTAA
Sequence MPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV
Source of smORF Swiss-Prot
Function The ORF matches to the profile of pfam09629. Profile Description: YorP protein. YorP is a 71 residue protein found in bacteria. As it is also found in a bacteriophage it might be of viral origin. The structure is of an alpha helix between two of five beta strands. The function is unknown.
Pubmed ID 9384377
Domain CDD:401532
Functional Category Others
Uniprot ID O31898
ORF Length (Amino Acid) 71
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2174104 2174319 - NC_000964.3 Bacillus subtilis subsp. subtilis str. 168
2 1819311 1819526 + NZ_CP048852.1 Bacillus tequilensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000964.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13238.8 1.0 2 148.0 same-strand AAA domain
2 PF06725.13 1.0 2 533.0 same-strand 3D domain
3 PF01368.22 1.0 2 4395.5 same-strand DHH family
4 PF17768.3 1.0 2 4395.5 same-strand RecJ OB domain
++ More..