Result : O31897
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YorQ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2173956 |
| Right | 2174111 |
| Strand | - |
| Nucleotide Sequence | ATGTTTAAAAAAGGTCAAAAGGTAATTGTTGATTTTACAGATGAGATTGGAGCTGTTGCGAAAGTTGATTATCGATACAACCAGATAGAAGTAAAGTATCCTGATGGCACTTACCAGGTTGTTGGATTTCATAAAGTAAGGAAGGTGGAGGATTAA |
| Sequence | MFKKGQKVIVDFTDEIGAVAKVDYRYNQIEVKYPDGTYQVVGFHKVRKVED |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31897 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2173956 | 2174111 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1819519 | 1819674 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2000624 | 2000785 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13238.8 | 0.67 | 2 | 0.0 | same-strand | AAA domain |
| 2 | PF09629.12 | 1.0 | 3 | -7 | same-strand | YorP protein |
| 3 | PF06725.13 | 1.0 | 3 | 741 | same-strand | 3D domain |
| 4 | PF17657.3 | 0.67 | 2 | 1294.0 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 5 | PF14579.8 | 0.67 | 2 | 1294.0 | same-strand | Helix-hairpin-helix motif |
++ More..