Result : O31878

Protein Information

• Protein name: SPbeta prophage-derived uncharacterized protein YosK
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 2166413
• Right: 2166613
• Strand: -
• Nucleotide Sequence: ATGTCGCAAAGTAATTATAGGCCGTCAGTTCCTAGATGGGTTGGCGATATACTAGAGCTAGACAAGAAAAGAAGACAAAATCAGTACAGAGGCTCACTAACGTCAGGTCAAGAGAAGAAGGACTGGGACGAGTGGAAGCGTAGATATTCAAGAAAATTAAAGTACGCAAGATTAAACGGATGGACGATCGAAGAAGAGTGA
• Sequence: MSQSNYRPSVPRWVGDILELDKKRRQNQYRGSLTSGQEKKDWDEWKRRYSRKLKYARLNGWTIEEE
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: O31878
• ORF Length (Amino Acid): 66

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2166413	2166613	-	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1827991	1828173	+	NZ_CP048852.1	Bacillus tequilensis
3	4779699	4779869	-	NZ_CP041305.1	Cytobacillus ciccensis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02867.17	0.67	2	1276.0	same-strand	Ribonucleotide reductase, barrel domain
2	PF08343.12	0.67	2	796.0	same-strand	Ribonucleotide reductase N-terminal
3	PF00317.23	0.67	2	796.0	same-strand	Ribonucleotide reductase, all-alpha domain
4	PF07972.13	0.67	2	438.0	same-strand	NrdI Flavodoxin like