Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YosU |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2158439 |
Right | 2158684 |
Strand | + |
Nucleotide Sequence | TTGCGAAAAATATTAAAAATCGTTAGCTTACTGATTCTATTGTTATTATTGGTTTATTCTTTCTTCAGTCCTAATTCACAATTATTTGTGTTCGTTCAGCTAATCATAATTGCATTTTTGATTGGTTTTGGAATTAACTGTTTTGTTAAAAAAGAACGATACCAAGGTACTCTATACTTCGTAATTGCAATATGCAACATTACCATTAATCTTGATAAAATAAACGAGTTAATTCAGAGCATTTAA |
Sequence | MRKILKIVSLLILLLLLVYSFFSPNSQLFVFVQLIIIAFLIGFGINCFVKKERYQGTLYFVIAICNITINLDKINELIQSI |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O31873 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2158439 | 2158684 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1869230 | 1869475 | - | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06445.17 | 1.0 | 2 | 40.0 | opposite-strand | GyrI-like small molecule binding domain |
2 | PF14526.8 | 1.0 | 2 | 40.0 | opposite-strand | Integron-associated effector binding protein |
3 | PF00692.21 | 1.0 | 2 | 574.0 | opposite-strand | dUTPase |