Result : O31873
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YosU |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2158439 |
| Right | 2158684 |
| Strand | + |
| Nucleotide Sequence | TTGCGAAAAATATTAAAAATCGTTAGCTTACTGATTCTATTGTTATTATTGGTTTATTCTTTCTTCAGTCCTAATTCACAATTATTTGTGTTCGTTCAGCTAATCATAATTGCATTTTTGATTGGTTTTGGAATTAACTGTTTTGTTAAAAAAGAACGATACCAAGGTACTCTATACTTCGTAATTGCAATATGCAACATTACCATTAATCTTGATAAAATAAACGAGTTAATTCAGAGCATTTAA |
| Sequence | MRKILKIVSLLILLLLLVYSFFSPNSQLFVFVQLIIIAFLIGFGINCFVKKERYQGTLYFVIAICNITINLDKINELIQSI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31873 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2158439 | 2158684 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1869230 | 1869475 | - | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06445.17 | 1.0 | 2 | 40.0 | opposite-strand | GyrI-like small molecule binding domain |
| 2 | PF14526.8 | 1.0 | 2 | 40.0 | opposite-strand | Integron-associated effector binding protein |
| 3 | PF00692.21 | 1.0 | 2 | 574.0 | opposite-strand | dUTPase |
++ More..