Result : O31865
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YotL |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2152927 |
| Right | 2153169 |
| Strand | + |
| Nucleotide Sequence | GTGAAAAAACAATGGAAACCAGTTGATTCAAGACTCAATGAGCTCATGCATGAATATAGCGTTTCAATTGAAGATCTTGTTGAATGTACTGGATTATCAAAACAACGTATTAATGATTATGTAGGTGGTTTTAAATCAAATATGAATATTGGAACAGCAATGACATTTGCTGATGCCATAGGTTGCTCTATAGAAGAGCTTTATGTATGGAACTTTAAAGAGCGCAGACAATTAACCAAATAA |
| Sequence | MKKQWKPVDSRLNELMHEYSVSIEDLVECTGLSKQRINDYVGGFKSNMNIGTAMTFADAIGCSIEELYVWNFKERRQLTK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9734814 9384377 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | O31865 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2152927 | 2153169 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1842762 | 1843001 | - | NZ_CP048852.1 | Bacillus tequilensis |
++ More..