Result : O31863
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YozD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2137602 |
| Right | 2137778 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAAATAGATCTTGTGATTGATACGGAAGAAATCGCTGAATTTTTTTACAGAGAGCTTGCAAGACGGGGCTACATACCGAGTGAGGATGAGCTGTTTGAAATCGCTGATATTACCTTTGATTATTTGATAGAAAAATGTATGATAGATGAAGAGCTGGATGAAGATGAGTGA |
| Sequence | MKEIDLVIDTEEIAEFFYRELARRGYIPSEDELFEIADITFDYLIEKCMIDEELDEDE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14162. Profile Description: YozD-like protein. The YozD-like protein family includes the B. subtilis YozD protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:316666 |
| Functional Category | Others |
| Uniprot ID | O31863 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2137602 | 2137778 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2070716 | 2070892 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 3985813 | 3985989 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2227601 | 2227777 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2080518 | 2080694 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2141270 | 2141446 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 2150407 | 2150583 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 1853774 | 1853947 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2096776 | 2096949 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2347088 | 2347258 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 2245907 | 2246077 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 2453500 | 2453670 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2862793 | 2862978 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 14 | 3071463 | 3071633 | - | NZ_CP053989.1 | Niallia circulans |
| 15 | 1712552 | 1712734 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 16 | 1971831 | 1972016 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 17 | 1608166 | 1608345 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 18 | 786009 | 786188 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 19 | 2331430 | 2331609 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 20 | 2988376 | 2988549 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 21 | 4435256 | 4435426 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 22 | 2231100 | 2231270 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 23 | 3797891 | 3798061 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 24 | 1086787 | 1086966 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 25 | 1795522 | 1795692 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 26 | 1439379 | 1439552 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 27 | 1976200 | 1976370 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 28 | 1794387 | 1794566 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 29 | 1481094 | 1481270 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 30 | 3402970 | 3403140 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 31 | 1912134 | 1912313 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 32 | 304481 | 304651 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 33 | 4989173 | 4989343 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 34 | 3312181 | 3312351 | + | NZ_CP043404.1 | Bacillus safensis |
| 35 | 2028094 | 2028264 | + | NZ_LS483476.1 | Lederbergia lentus |
| 36 | 3863435 | 3863617 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 37 | 1772464 | 1772643 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 38 | 2933745 | 2933924 | - | NZ_CP040336.1 | Bacillus luti |
| 39 | 2150918 | 2151097 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 40 | 2191655 | 2191834 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 41 | 2189867 | 2190046 | + | NC_011725.1 | Bacillus cereus B4264 |
| 42 | 2219945 | 2220124 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 43 | 282192 | 282371 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 44 | 3805624 | 3805797 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 45 | 2955090 | 2955260 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 46 | 1959934 | 1960116 | - | NZ_CP012024.1 | Bacillus smithii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06855.14 | 0.93 | 43 | 1094 | same-strand | YozE SAM-like fold |
| 2 | PF04055.23 | 0.67 | 31 | 1681 | same-strand | Radical SAM superfamily |
++ More..