Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP000544.1 |
Organism | Halorhodospira halophila (strain DSM 244 / SL1) (Ectothiorhodospira halophila (strain DSM 244 / SL1)) |
Left | 2188035 |
Right | 2188298 |
Strand | + |
Nucleotide Sequence | ATGAGCGAGACCGATTCTCAGGAAACCGCCCCCCAGGGCGACCTCCCCGACTTCGAGCGCTCGGTGGCCGAACTTGAGGCCCTGATCGAACGCATGGAGCGTGGCGAACAGACCCTTGAGGAGGCCCTGCGCGACTTTGAACGGGGCATCCACCTGACCCGCCACTGCCAGAAGGCGCTGAGCGCCGCCGAGCAGAAAGTGGCTATCCTACTCGAGAACAGCGAGGACGGTGATGTCGGCCCGTTTCGACCCGACGATTCTTGA |
Sequence | MSETDSQETAPQGDLPDFERSVAELEALIERMERGEQTLEEALRDFERGIHLTRHCQKALSAAEQKVAILLENSEDGDVGPFRPDDS |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | A1WYI6 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2188035 | 2188298 | + | NC_008789.1 | Halorhodospira halophila SL1 |
2 | 927458 | 927673 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
3 | 1956226 | 1956504 | + | NZ_LR699119.1 | Aquicella siphonis |
4 | 722438 | 722680 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
5 | 1092266 | 1092508 | - | NZ_CP060009.1 | Pseudomonas sediminis |
6 | 2535128 | 2535385 | + | NZ_AP014936.1 | Sulfurifustis variabilis |
7 | 916624 | 916866 | - | NZ_AP022642.1 | Pseudomonas otitidis |
8 | 1414908 | 1415150 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
9 | 707804 | 708046 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
10 | 4366993 | 4367238 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
11 | 800490 | 800732 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
12 | 1351365 | 1351616 | + | NC_021291.1 | Spiribacter salinus M19-40 |
13 | 3675247 | 3675501 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
14 | 604354 | 604608 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
15 | 5124117 | 5124359 | + | NZ_CP024159.1 | Pseudomonas mosselii |
16 | 2538697 | 2538939 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
17 | 5912524 | 5912766 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
18 | 3560038 | 3560292 | + | NZ_CP020931.1 | Marinobacter salarius |
19 | 899791 | 900048 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
20 | 2763578 | 2763820 | - | NZ_CP042941.1 | Atlantibacter hermannii |
21 | 2021683 | 2021931 | - | NZ_CP060092.1 | Teredinibacter purpureus |
22 | 865300 | 865542 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
23 | 495347 | 495589 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
24 | 3679573 | 3679830 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
25 | 1620541 | 1620798 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
26 | 96096 | 96314 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
27 | 1706373 | 1706660 | - | NZ_CP014671.1 | Immundisolibacter cernigliae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00348.19 | 1.0 | 27 | -3 | same-strand | Polyprenyl synthetase |