Result : O31861
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YojB |
| NCBI Accession ID | AF026147.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1426 |
| Right | 1662 |
| Strand | + |
| Nucleotide Sequence | ATGTACCCTCATCATTCGTATTTACGCGGAATCCCAGGTCCAGCCGGATATCCGGCGCGTAGTCCTTTTTTGTTTGGCGCTCCTCTAGTCGGCGGTTTATTAGGCGGTTTTCTCGGGAGTGCGCTGTTTAACTATTCTCGTCCCTATGCCTATCCTCCTGGCCCTTATGGATATGGAGGCGGACCGTACGGTTTTGGTGCCGGCGTGCCATACGGGGGATATCCCGGCTTCTATTAA |
| Sequence | MYPHHSYLRGIPGPAGYPARSPFLFGAPLVGGLLGGFLGSALFNYSRPYAYPPGPYGYGGGPYGFGAGVPYGGYPGFY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9734814 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31861 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2124529 | 2124765 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2067406 | 2067642 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2139569 | 2139805 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2058242 | 2058472 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 2215115 | 2215351 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2129530 | 2129766 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02585.19 | 1.0 | 6 | 2209.0 | same-strand | GlcNAc-PI de-N-acetylase |
| 2 | PF08830.12 | 1.0 | 6 | 1840.0 | same-strand | Protein of unknown function (DUF1806) |
| 3 | PF00892.22 | 1.0 | 6 | 593.5 | same-strand | EamA-like transporter family |
| 4 | PF14552.8 | 0.83 | 5 | 1092 | opposite-strand | Tautomerase enzyme |
| 5 | PF01361.23 | 0.83 | 5 | 1092 | opposite-strand | Tautomerase enzyme |
| 6 | PF01638.19 | 1.0 | 6 | 1994.0 | same-strand | HxlR-like helix-turn-helix |
| 7 | PF00881.26 | 1.0 | 6 | 2462.0 | opposite-strand | Nitroreductase family |
| 8 | PF02230.18 | 0.83 | 5 | 3097 | same-strand | Phospholipase/Carboxylesterase |
++ More..