| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YozN |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2098859 |
| Right | 2099122 |
| Strand | + |
| Nucleotide Sequence | GTGGTTCAACCAACTCCGTATATCAATATTAATATTTTCATGCTGAAAATTAATTCCTTTGAAAATGCTTCAGCGGTTAACGTAGGACAAAATTTATTGGCAGAATGGCAAAATTCAGATAAAAAAAATCAAGGCTACGGACAGAATTTTGGAGATGCGAGCGGATTTATGGGCACGAGAAGCCATGTGGATGACAGAGACCAAATTGATTCTCCGGCCTCTTTTGAAAGTGAAGCGGTTAACTCCTCAATCAAAAGGAAGTGA |
| Sequence | MVQPTPYININIFMLKINSFENASAVNVGQNLLAEWQNSDKKNQGYGQNFGDASGFMGTRSHVDDRDQIDSPASFESEAVNSSIKRK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O31846 |
| ORF Length (Amino Acid) | 87 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2098859 | 2099122 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2113922 | 2114182 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 890350 | 890607 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 4 | 784761 | 785018 | - | NZ_CP043404.1 | Bacillus safensis |
| 5 | 717509 | 717766 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 6 | 1895519 | 1895791 | - | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 2406237 | 2406497 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 8 | 2054894 | 2055166 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2770248 | 2770499 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 10 | 3287734 | 3287952 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 11 | 2095224 | 2095436 | - | NZ_CP033433.1 | Cohnella candidum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00011.23 | 1.0 | 11 | 70 | opposite-strand | Hsp20/alpha crystallin family |
| 2 | PF17886.3 | 0.91 | 10 | 69.0 | opposite-strand | HSP20-like domain found in ArsA |
| 3 | PF10676.11 | 0.91 | 10 | 7.0 | same-strand | Spore germination protein gerPA/gerPF |